DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and aebp1b

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio


Alignment Length:163 Identity:35/163 - (21%)
Similarity:62/163 - (38%) Gaps:31/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 RDDNSRIAINKNHIVNEWEGDTL---EITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPML 316
            |:..:.:.:..:.:|..||.:.|   ..:.||..|...:  :....| .:|...::|.: .||..
Zfish     5 RNQKTLVVLCLSLLVPSWEVNGLTEHSKSEISHTDREQH--VEDRNV-TSVEDLLQVKI-IPPYA 65

  Fly   317 LIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTH------ 375
            .|       ..|.:..:.|...:...::| |....|..:...|          ...|.|      
Zfish    66 TI-------EVGQHKQLLCKVSSDAKNIN-WVSPNGEKVLTKH----------GNLKVHNHGSVL 112

  Fly   376 MKLTIINVSSGDDGIYKCVAKNPRGETDGIIRL 408
            ..||::|.:..:.|||||||.|...|:...::|
Zfish   113 SSLTVLNANLNNAGIYKCVATNGDTESQATVKL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653
Ig 130..200 CDD:143165
I-set 226..310 CDD:254352 11/57 (19%)
IGc2 233..298 CDD:197706 8/45 (18%)
Ig 313..410 CDD:299845 24/102 (24%)
IG_like 325..410 CDD:214653 21/90 (23%)
aebp1bXP_696022.6 Ig 56..147 CDD:299845 25/109 (23%)
IG_like 62..145 CDD:214653 23/100 (23%)
FA58C 402..555 CDD:238014
FA58C 403..556 CDD:214572
Peptidase_M14_like 577..1036 CDD:299699
Peptidase_M14NE-CP-C_like 1040..1115 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.