DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and iglon5

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:302 Identity:89/302 - (29%)
Similarity:141/302 - (46%) Gaps:36/302 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 EFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRH 178
            ||....:|:||..|.:|.|.|.:....::| ||::  :|.||.......:.:.|:|:   :::.:
Zfish    28 EFGHLPDNITVLEGESVVLRCKIDEEVTHK-AWLN--RSNILFTGTDKWSLDSRVSL---ENNNN 86

  Fly   179 RTWYLHINNVHEEDRGRYMCQINTVT-AKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCR 242
            ..:.:.|..|...|.|.|.|...... .:|...||.|.||..|.:  .|.|..|.||.:::|.|.
Zfish    87 SDFSIRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIVN--ISQDKSVNEGEDVNLFCL 149

  Fly   243 ASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIK 307
            |.|.|.|.|.||.        .|..::|  ||:.||||.|.|.....:.||.:|||.|..::::|
Zfish   150 AVGRPEPTITWKD--------FKYGLLN--EGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVK 204

  Fly   308 VSVDFPPMLL----IPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGE-GPIIHDSHKYKVEATV 367
            |:|::||::.    :|.|:     |....:.|...|.||:...|.|.: .|:..|:       |:
Zfish   205 VTVNYPPIITDVKNMPAQV-----GKTAILRCEAMAVPTASFEWYRDDRRPVESDN-------TL 257

  Fly   368 GLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLY 409
            .:...||...|...||:....|.|.|.|.|..|.::..:.|:
Zfish   258 KIKNEKTRSLLLFTNVTEKHFGNYTCFASNRLGASNASMLLF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 25/96 (26%)
Ig 130..200 CDD:143165 17/69 (25%)
I-set 226..310 CDD:254352 32/83 (39%)
IGc2 233..298 CDD:197706 24/64 (38%)
Ig 313..410 CDD:299845 26/102 (25%)
IG_like 325..410 CDD:214653 22/86 (26%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 24/95 (25%)
Ig 35..123 CDD:299845 24/93 (26%)
Ig 125..>183 CDD:299845 27/69 (39%)
I-set 128..207 CDD:254352 33/90 (37%)
IG_like 217..298 CDD:214653 23/92 (25%)
ig 223..296 CDD:278476 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576314
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.