DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr6

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:264 Identity:79/264 - (29%)
Similarity:112/264 - (42%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NGAGGGGPVAGSG------TGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTE-YIE-----N 121
            || |..||:.|..      |.:...|...:::    ...||:    ....|::.| |.:     |
  Fly    27 NG-GVQGPIEGYNSLDDLLTTTPTPGQAALLL----PTAPTA----AYTHPKWMEPYFDPSTPRN 82

  Fly   122 VTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHIN 186
            ||...|::..|.|.|:||.:..|:|:......||||.::..|.:.|...||  |.....|.|.|.
  Fly    83 VTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATH--HQDTEDWTLQIK 145

  Fly   187 NVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRP-- 249
            ...:.|.|.|.|||:|...::.|..||||||  ....|...|:.|.:|:.|:|.|....||.|  
  Fly   146 WAQKRDAGMYECQISTQPVRSYFVRLNVVVP--TATILGGPDLHVDKGSTINLTCTVKFSPEPPA 208

  Fly   250 IIKWKRD------DNSRIAINKNHIVNEWEGDT----LEITRISRLDMGAYLCIASNGVPPTVSK 304
            .|.|...      |:||..::   ::.| :||.    |.|......|.|.|.|..||.  ...|.
  Fly   209 YIFWYHHEEVINYDSSRGGVS---VITE-KGDVTTSFLLIQNADLADSGKYSCAPSNA--DVASV 267

  Fly   305 RIKV 308
            |:.|
  Fly   268 RVHV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 34/100 (34%)
Ig strand B 130..134 CDD:409405 1/3 (33%)
Ig strand C 143..147 CDD:409405 1/3 (33%)
Ig strand E 178..185 CDD:409405 2/6 (33%)
IgI_1_MuSK 218..310 CDD:409562 29/103 (28%)
Ig strand A 218..221 CDD:409562 0/2 (0%)
Ig strand A' 226..231 CDD:409562 1/4 (25%)
Ig strand B 237..244 CDD:409562 3/6 (50%)
Ig strand C 250..255 CDD:409562 2/4 (50%)
Ig strand C' 257..259 CDD:409562 1/1 (100%)
Ig strand D 267..270 CDD:409562 0/2 (0%)
Ig strand E 275..281 CDD:409562 3/9 (33%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 3/7 (43%)
IG_like 325..410 CDD:214653
Ig strand B 331..335 CDD:143207
Ig strand C 344..348 CDD:143207
Ig strand E 376..380 CDD:143207
Ig strand F 390..395 CDD:143207
Ig strand G 403..406 CDD:143207
dpr6NP_001287018.1 FR1 79..96 CDD:409355 5/16 (31%)
IG_like 80..175 CDD:214653 34/96 (35%)
Ig strand A' 83..85 CDD:409355 1/1 (100%)
Ig strand B 89..97 CDD:409355 2/7 (29%)
CDR1 97..104 CDD:409355 3/6 (50%)
FR2 105..114 CDD:409355 2/8 (25%)
Ig strand C 105..110 CDD:409355 2/4 (50%)
CDR2 115..129 CDD:409355 5/13 (38%)
Ig strand D 129..135 CDD:409355 2/7 (29%)
FR3 130..159 CDD:409355 10/30 (33%)
Ig strand E 139..145 CDD:409355 2/5 (40%)
Ig strand F 153..160 CDD:409355 4/6 (67%)
IG_like 184..271 CDD:214653 27/92 (29%)
Ig strand B 194..198 CDD:409353 2/3 (67%)
Ig strand C 209..213 CDD:409353 1/3 (33%)
Ig strand E 240..244 CDD:409353 1/3 (33%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.