DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and NCAM1

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001387553.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:1129 Species:Homo sapiens


Alignment Length:453 Identity:101/453 - (22%)
Similarity:178/453 - (39%) Gaps:86/453 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SGTGSTVVGSN----GV---IVAGGGANVPTSNLNIVVEEPEFTEYI-ENVTVP----AGRNVKL 132
            |.:..|:..:|    |:   :|.|...:...:.:|:.:    |.:.: :|...|    .|.:..:
Human    77 SSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKI----FQKLMFKNAPTPQEFREGEDAVI 137

  Fly   133 GCSVKNLGSYKVAWMHFEQSAIL--TVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGR 195
            .|.|.:.....:.|.|..:..||  .|...|::.|                ||.|..:.:.|.|.
Human   138 VCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNN----------------YLQIRGIKKTDEGT 186

  Fly   196 YMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGAN----ISLRCRASGSPRPIIKWKRD 256
            |.|: ..:.|:.:..:.::.|..|:..::.:...||...||    ::|.|.|.|.|.|.:.|.:|
Human   187 YRCE-GRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKD 250

  Fly   257 DN--SRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGV-PPTVSKRIKVSVDFPPMLLI 318
            ..  .:...::.:|.:: :...|.|.::.:.|...|:|||.|.. ....:..:||... |.:..:
Human   251 GEQIEQEEDDEKYIFSD-DSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAK-PKITYV 313

  Fly   319 PHQLVGAPEGFNVTIECFTEAHP-TSLNY--------------WTRGEGPIIHDSHKYKVEATVG 368
            .:|.....|. .||:.|.....| .|:.:              |||.|          |.|...|
Human   314 ENQTAMELEE-QVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPE----------KQETLDG 367

  Fly   369 LPAYKTHMK---LTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASS-GIYSTDTHWG 429
            ....::|.:   ||:.::...|.|.|.|.|.|..|:....:.|.|.|.|..... .:|:    |.
Human   368 HMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYT----WE 428

  Fly   430 ENGIN---NNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGL--SEQKSFLDKTQNPLLANGNAN 487
            .|.:|   ..:||  |.:|.| :.:|......||.:.|.:  :...|:|:.|.:.....||.|
Human   429 GNQVNITCEVFAY--PSATIS-WFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYN 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/101 (20%)
Ig strand B 130..134 CDD:409405 0/3 (0%)
Ig strand C 143..147 CDD:409405 0/3 (0%)
Ig strand E 178..185 CDD:409405 2/6 (33%)
IgI_1_MuSK 218..310 CDD:409562 24/98 (24%)
Ig strand A 218..221 CDD:409562 1/2 (50%)
Ig strand A' 226..231 CDD:409562 0/4 (0%)
Ig strand B 237..244 CDD:409562 2/6 (33%)
Ig strand C 250..255 CDD:409562 1/4 (25%)
Ig strand C' 257..259 CDD:409562 0/3 (0%)
Ig strand D 267..270 CDD:409562 1/2 (50%)
Ig strand E 275..281 CDD:409562 2/5 (40%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 2/7 (29%)
IG_like 325..410 CDD:214653 24/102 (24%)
Ig strand B 331..335 CDD:143207 2/3 (67%)
Ig strand C 344..348 CDD:143207 0/17 (0%)
Ig strand E 376..380 CDD:143207 1/6 (17%)
Ig strand F 390..395 CDD:143207 2/4 (50%)
Ig strand G 403..406 CDD:143207 0/2 (0%)
NCAM1NP_001387553.1 IgI_1_NCAM-1 20..116 CDD:409451 7/42 (17%)
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451 2/7 (29%)
Ig strand F 92..100 CDD:409451 2/7 (29%)
Ig strand G 104..115 CDD:409451 1/14 (7%)
IG_like 124..190 CDD:214653 17/81 (21%)
Ig strand B 135..139 CDD:409353 0/3 (0%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 3/19 (16%)
Ig 211..307 CDD:472250 23/96 (24%)
Ig strand B 231..235 CDD:409353 1/3 (33%)
Ig strand C 244..248 CDD:409353 0/3 (0%)
Ig strand E 270..274 CDD:409353 1/3 (33%)
Ig strand F 284..289 CDD:409353 2/4 (50%)
Ig strand G 297..300 CDD:409353 0/2 (0%)
IgI_NCAM-1 306..412 CDD:143277 26/117 (22%)
Ig strand A 306..311 CDD:143277 1/5 (20%)
Ig strand A' 315..319 CDD:143277 1/3 (33%)
Ig strand B 324..332 CDD:143277 3/7 (43%)
Ig strand C 338..344 CDD:143277 1/5 (20%)
Ig strand C' 347..350 CDD:143277 0/2 (0%)
Ig strand D 368..374 CDD:143277 0/5 (0%)
Ig strand E 377..383 CDD:143277 2/5 (40%)
Ig strand F 391..399 CDD:143277 4/7 (57%)
Ig strand G 402..412 CDD:143277 2/9 (22%)
IG_like 421..499 CDD:214653 19/75 (25%)
Ig strand B 432..436 CDD:409353 1/3 (33%)
Ig strand C 445..449 CDD:409353 2/4 (50%)
Ig strand E 472..476 CDD:409353 2/3 (67%)
Ig strand F 486..491 CDD:409353 2/3 (67%)
fn3 511..598 CDD:394996
fn3 612..693 CDD:394996
PRK12323 <913..1108 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.