DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and Dscam3

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:557 Identity:126/557 - (22%)
Similarity:190/557 - (34%) Gaps:170/557 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIGALLV------LAATAGDSTNKIIL---PQILNGGGGGGGVG-TAQGKHP--------SGSKT 54
            |:||||:      |.||:|......:|   |::|.|...|..|. ||.|..|        .||  
  Fly    16 LLGALLLAVLATPLLATSGLRVPTFLLEPAPRLLFGNDTGAQVTCTAHGSPPPLVTWVLRDGS-- 78

  Fly    55 VATGVVPNFGGAAGNGAGGGGP----------------VAGSGTGSTVVGSNGVIVAGGGANVPT 103
            :|| .||.....:|||.....|                ...|....||:..|..:.|     |..
  Fly    79 LAT-QVPGLRKISGNGTLHFPPFLAQYYRTDVHEATYRCRASNEAGTVLSRNVQVHA-----VVR 137

  Fly   104 SNLNIVVEEPE------------FTEYI------------ENVTVP-----AGRNVKLGCS---- 135
            ...::.||..|            ..||:            |.:.:|     |||.|.|..|    
  Fly   138 RQFHVHVENTEVYLGNSALIKCAIPEYVRPYVRVASWHRGEEILLPDLSDVAGRYVVLAASGDLY 202

  Fly   136 VKNLGSYKVAWMHF------------EQSAILTVHNHVITRN--PR-----ISVTHDK--HDRHR 179
            |:::.| :...|.|            ::|..:.:....:::|  ||     :...|.:  :|.|.
  Fly   203 VRSVRS-EDGLMKFSCLVTNTLNGERQRSDAVMLQVKELSKNLAPRTTQKPVMEIHVERGNDVHL 266

  Fly   180 ------------TWY-----------------------LHINNVHEEDRGRYMCQINTVTAKTQF 209
                        |||                       |.|.|..|.|.|:::||     |..||
  Fly   267 PCNIQGNPFPIFTWYRVSDSAALYPIPSSQRVILSRTLLLIKNADERDAGKWICQ-----ASNQF 326

  Fly   210 G------------YLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDD----- 257
            |            |::|.:.|.:.        ||..|...:..|..:||....|.|..:.     
  Fly   327 GEQRIEIRLSVNSYVSVHILPQVQ--------IVNSGGTANFNCTTTGSAIDAIDWLHNGKPLQA 383

  Fly   258 NSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN-GVPPTVSKRIKVSVDFPPMLLIPHQ 321
            |:.:...:::| ......:|.:..:.|.|.|.|.|:..| .........:|:. |..|.|:....
  Fly   384 NNALTTGRDNI-RFLSKSSLLVQNVGRRDRGVYQCLVENQRASAQAMAELKLG-DTVPELIYTFI 446

  Fly   322 LVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDS--HKYKVEATVGLPA-YKTHMKLTIINV 383
            ......|..::::|.....|.....|.....||:..|  |::.:...|.:.. ..:|  |.|.:|
  Fly   447 EQNVRPGPLISLKCSASGSPPPQFAWLLDSQPIMDVSLHHRFAIGQFVDMSGDVISH--LNISHV 509

  Fly   384 SSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSG 420
            ...|.|:|||||.|..|......||.|..||...:.|
  Fly   510 RPDDGGLYKCVASNSMGSVQHSARLNVYGPPYVRAIG 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 36/172 (21%)
Ig 130..200 CDD:143165 24/129 (19%)
I-set 226..310 CDD:254352 18/89 (20%)
IGc2 233..298 CDD:197706 15/70 (21%)
Ig 313..410 CDD:299845 26/99 (26%)
IG_like 325..410 CDD:214653 24/87 (28%)
Dscam3NP_996226.2 IG 56..133 CDD:214652 19/79 (24%)
Ig 56..125 CDD:143165 16/71 (23%)
I-set 246..337 CDD:254352 20/95 (21%)
Ig 264..334 CDD:143165 16/74 (22%)
I-set 345..433 CDD:254352 18/96 (19%)
Ig 358..431 CDD:143165 14/73 (19%)
Ig 456..533 CDD:143165 21/78 (27%)
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.