DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr13

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:337 Identity:81/337 - (24%)
Similarity:119/337 - (35%) Gaps:98/337 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PSGSKTVATGVV-----PNFGGAAGN----GAGGGGPV---------AGSGTGSTVVGSNGVIVA 95
            |.|.||||..:.     |:......|    .:..|.||         |.|..||::...:...|.
  Fly    46 PGGGKTVAATMTTPASEPSVRHINQNLIMSQSKEGEPVPVPQPYAQSAASAGGSSITSFDSTNVI 110

  Fly    96 GGGANVPTSNLN----------------------IVVEEPEFTE--------------------- 117
            .|.:....::|.                      |.|..||..|                     
  Fly   111 DGQSQPTPTHLQEAVLQTHSHSRIQAKDTAGPYPIPVHRPEPVENHLEANNGIEGGMESLFGTPM 175

  Fly   118 YI--EN---VTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDR 177
            |.  ||   ||...|....:.|:|.::|...|:|:..:...:|||.....:.:.|.|.||.||. 
  Fly   176 YFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHS- 239

  Fly   178 HRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVV-------PPNIDDSLSSSDVIVR--- 232
             ..|.|.|..|...|.|.|.||::|....:.|.:|:||.       ||            :|   
  Fly   240 -EDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPP------------IRYLT 291

  Fly   233 EGANISLRCRA--SGSPRPIIKWKRDDNSRIAINKNHIVN-----EWEGDTLEITRISRLDMGAY 290
            .|:.:.|:||.  :......|.|.. ||..|..:.:..:|     :::...|.|.|..|...|.:
  Fly   292 PGSTLRLQCRVVQNTEASEYIFWYH-DNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNF 355

  Fly   291 LCIASNGVPPTV 302
            .|:|||..|.:|
  Fly   356 TCVASNTQPASV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 32/98 (33%)
Ig 130..200 CDD:143165 22/69 (32%)
I-set 226..310 CDD:254352 22/87 (25%)
IGc2 233..298 CDD:197706 19/71 (27%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
dpr13NP_001033956.2 V-set 180..276 CDD:284989 31/97 (32%)
IG_like 182..262 CDD:214653 26/81 (32%)
IG_like 285..362 CDD:214653 21/89 (24%)
IGc2 292..361 CDD:197706 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.