DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr20

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:371 Identity:79/371 - (21%)
Similarity:120/371 - (32%) Gaps:97/371 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GGGGVGTAQGKHPSGSK-------------------TVATGVVPNFGGAAGNGAGGGGPVAGSGT 82
            |.|.|........||.|                   ||||   .:.|..:.:.|....|...:..
  Fly   152 GSGTVSPKSSPDSSGHKKNASFQQIGSQNVNALVPATVAT---TSSGLPSSSNASLATPTEPARN 213

  Fly    83 GSTVVGSNGVIVAGG------GANVPTSNLNIVVEE---------------PEFTE-----YIEN 121
            .||.:..|..:....      |.......||.:.:.               |.|.:     ...|
  Fly   214 RSTGLVRNSAVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATN 278

  Fly   122 VTVPAGRNVKLGCSVKNLGSYKVAWM-HFEQSA---------ILTVHNHVITRNPRISVTHDKHD 176
            :||.||.::.|.|.:..|....|:|: |..|..         :|||..|..|.:.|..:   :..
  Fly   279 LTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKM---EFQ 340

  Fly   177 RHRTWYLHINNVHEEDRGRYMCQINT-----VTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGAN 236
            ....|.|.|.||.::|...|.|||:|     :..........|::...:.|.|......:.....
  Fly   341 YPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQ 405

  Fly   237 ISLRCRASGSPRPIIKWKRDDN------SRIAIN-KNHIVNEWEGDTLEITRISRLDMGAYLCIA 294
            :|...|.......::.||..||      :|..:: |..::.:....||.|.:||:.|.|.|.|..
  Fly   406 LSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSI 470

  Fly   295 SNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAH 340
            |               :|....::.|.|.|         |.|.|.|
  Fly   471 S---------------EFQNFTIVVHILNG---------ESFAELH 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/110 (27%)
Ig 130..200 CDD:143165 21/79 (27%)
I-set 226..310 CDD:254352 18/90 (20%)
IGc2 233..298 CDD:197706 18/71 (25%)
Ig 313..410 CDD:299845 7/28 (25%)
IG_like 325..410 CDD:214653 4/16 (25%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 27/89 (30%)
Ig 279..378 CDD:299845 28/101 (28%)
Ig 400..471 CDD:299845 17/70 (24%)
IG_like 402..480 CDD:214653 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.