DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and Dscam1

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:466 Identity:100/466 - (21%)
Similarity:159/466 - (34%) Gaps:134/466 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PEFTEYIENVTVPAGRNVKLGCSV-KNLGSYKVAWMHFEQSAILTVHNHV--ITRNPRISVTHDK 174
            |:...:.....:..|.::.|.|.: |.....||.| .||:||.....:.|  ..|..|||     
  Fly   622 PQIVPFAYEDLINMGDSIDLFCQIQKGDRPIKVHW-SFERSAGDYGFDQVQPQMRTNRIS----- 680

  Fly   175 HDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGY-LNVVVPPNIDDSLSSSDVIVREGANIS 238
               .:|..:.|.:......||..|..:.....|.:.. |.|.|||..  .|..:|....:|::..
  Fly   681 ---EKTSMISIPSASPAHTGRDTCIASNKAGTTTYSVDLTVNVPPRW--ILEPTDKAFAQGSDAK 740

  Fly   239 LRCRASGSPRPIIKW--------------KRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGA 289
            :.|:|.|.|:|.:.|              |:.||.|:           |..||.:..|.:.:.|.
  Fly   741 VECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRV-----------EEGTLHVDNIQKTNEGY 794

  Fly   290 YLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTE---------AHPTSLN 345
            |||.|.||:...:|..|.:||..||.                    |||         ..|..|.
  Fly   795 YLCEAINGIGSGLSAVIMISVQAPPE--------------------FTEKLRNQTARRGEPAVLQ 839

  Fly   346 YWTRGEGPI------------IHDSHKYKVEATV---GLPAYKTHMKLTIINVSSGDDGIYKCVA 395
            ...:||.||            ..:.::|.:...:   |:.:     .|:|......|..::.|||
  Fly   840 CEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMS-----SLSIKRTERSDSALFTCVA 899

  Fly   396 KNPRGETDGIIRLYVSYPP-------TTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDK 453
            .|..|..|..|.:.|...|       ....|| .|....|.:       .|.|.........:.|
  Fly   900 TNAFGSDDASINMIVQEVPEMPYALKVLDKSG-RSVQLSWAQ-------PYDGNSPLDRYIIEFK 956

  Fly   454 NTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAES-NGARGHNPSMAIAWLFVVIATLLL 517
            .:|  ::.:||             :.::..|:..||..:. :.|..:|              :.:
  Fly   957 RSR--ASWSEI-------------DRVIVPGHTTEAQVQKLSPATTYN--------------IRI 992

  Fly   518 TIRSAVGSSHS 528
            ...:|:|:|.|
  Fly   993 VAENAIGTSQS 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/99 (24%)
Ig 130..200 CDD:143165 20/72 (28%)
I-set 226..310 CDD:254352 25/97 (26%)
IGc2 233..298 CDD:197706 21/78 (27%)
Ig 313..410 CDD:299845 23/120 (19%)
IG_like 325..410 CDD:214653 21/108 (19%)
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165 21/81 (26%)
IGc2 735..804 CDD:197706 22/79 (28%)
I-set 819..914 CDD:254352 22/119 (18%)
Ig 833..921 CDD:299845 20/92 (22%)
FN3 918..1011 CDD:238020 20/123 (16%)
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.