DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr19

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:327 Identity:75/327 - (22%)
Similarity:129/327 - (39%) Gaps:54/327 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRY 196
            |.|.||......|:|:..:...:|||.....:.:.|..|.|.:|..|  |.|.|..|.|||||.|
  Fly    60 LPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGH--WSLRIKAVREEDRGFY 122

  Fly   197 MCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRC---RASGSPRPIIKWKRDDN 258
            .||::..  .||...:.:.:...:.:..|:.::.:.|.:.:.|.|   ||:.:| ..:.|..|  
  Fly   123 ECQLS
IY--PTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENP-AFVFWYHD-- 182

  Fly   259 SRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLV 323
                   :.::|........:|.|.:.:..:.....|:   |....|..:.::....:|  :.|:
  Fly   183 -------SKMINYDSQGGFVVTSIGQSNPQSGQFYRSS---PANKSRATMPMESSNGVL--NSLL 235

  Fly   324 GAPEGF-----NVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINV 383
            |:.:..     ||         |:|..|.|:.     |.| .|.:..:|.:        ||:..|
  Fly   236 GSSDAIKAPAANV---------PSSTPYMTQQ-----HQS-AYLLNPSVSV--------LTVKQV 277

  Fly   384 SSGDDGIYKCVAKN--PRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTR 446
            :....|.|.|...|  |...|..::|...:.....|:..|..|:|:  .||.......||.:.|.
  Fly   278 NFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILDTETN--GNGTFGLITLGGLNGTS 340

  Fly   447 SI 448
            .:
  Fly   341 GV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 28/83 (34%)
Ig strand B 130..134 CDD:409405 1/1 (100%)
Ig strand C 143..147 CDD:409405 1/3 (33%)
Ig strand E 178..185 CDD:409405 3/6 (50%)
IgI_1_MuSK 218..310 CDD:409562 15/94 (16%)
Ig strand A 218..221 CDD:409562 0/2 (0%)
Ig strand A' 226..231 CDD:409562 0/4 (0%)
Ig strand B 237..244 CDD:409562 3/9 (33%)
Ig strand C 250..255 CDD:409562 1/4 (25%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 0/2 (0%)
Ig strand E 275..281 CDD:409562 0/5 (0%)
Ig strand F 288..295 CDD:409562 0/6 (0%)
Ig strand G 302..310 CDD:409562 1/7 (14%)
IG_like 325..410 CDD:214653 20/91 (22%)
Ig strand B 331..335 CDD:143207 1/3 (33%)
Ig strand C 344..348 CDD:143207 1/3 (33%)
Ig strand E 376..380 CDD:143207 1/3 (33%)
Ig strand F 390..395 CDD:143207 2/4 (50%)
Ig strand G 403..406 CDD:143207 0/2 (0%)
dpr19NP_609392.1 IG_like 50..127 CDD:214653 26/68 (38%)
Ig strand B 58..62 CDD:409353 1/1 (100%)
Ig strand C 71..75 CDD:409353 1/3 (33%)
Ig strand E 107..111 CDD:409353 2/3 (67%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 9/40 (23%)
Ig strand E 270..274 CDD:409551 1/11 (9%)
Ig strand F 284..289 CDD:409551 2/4 (50%)

Return to query results.
Submit another query.