DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr19

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:327 Identity:75/327 - (22%)
Similarity:129/327 - (39%) Gaps:54/327 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRY 196
            |.|.||......|:|:..:...:|||.....:.:.|..|.|.:|..|  |.|.|..|.|||||.|
  Fly    60 LPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGH--WSLRIKAVREEDRGFY 122

  Fly   197 MCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRC---RASGSPRPIIKWKRDDN 258
            .||::..  .||...:.:.:...:.:..|:.::.:.|.:.:.|.|   ||:.:| ..:.|..|  
  Fly   123 ECQLS
IY--PTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENP-AFVFWYHD-- 182

  Fly   259 SRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLV 323
                   :.::|........:|.|.:.:..:.....|:   |....|..:.::....:|  :.|:
  Fly   183 -------SKMINYDSQGGFVVTSIGQSNPQSGQFYRSS---PANKSRATMPMESSNGVL--NSLL 235

  Fly   324 GAPEGF-----NVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINV 383
            |:.:..     ||         |:|..|.|:.     |.| .|.:..:|.:        ||:..|
  Fly   236 GSSDAIKAPAANV---------PSSTPYMTQQ-----HQS-AYLLNPSVSV--------LTVKQV 277

  Fly   384 SSGDDGIYKCVAKN--PRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTR 446
            :....|.|.|...|  |...|..::|...:.....|:..|..|:|:  .||.......||.:.|.
  Fly   278 NFRHAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILDTETN--GNGTFGLITLGGLNGTS 340

  Fly   447 SI 448
            .:
  Fly   341 GV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 28/83 (34%)
Ig 130..200 CDD:143165 25/67 (37%)
I-set 226..310 CDD:254352 14/86 (16%)
IGc2 233..298 CDD:197706 12/67 (18%)
Ig 313..410 CDD:299845 23/103 (22%)
IG_like 325..410 CDD:214653 20/91 (22%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 26/68 (38%)
IGc2 55..125 CDD:197706 24/66 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.