DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and bdl

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:357 Identity:77/357 - (21%)
Similarity:122/357 - (34%) Gaps:102/357 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 NVTVPAGRNVKLGCSVKNLGS----YKVAWMH--------FEQ----SAILTVHNHVITRNP--- 166
            |:....|.:|...|.:.....    |.|.|..        :||    |.:.....|::..:|   
  Fly    42 NLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFG 106

  Fly   167 RISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQI----------NTVTA---KTQFGYLNVVVPP 218
            |.||             ::..:.|.|:|.|.||:          |..||   ..|.|.| :.:||
  Fly   107 RASV-------------NLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSL-IRIPP 157

  Fly   219 NIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGD-------- 275
                    .:..:|||......|          ..|..:||:.:..|:.::.:...|        
  Fly   158 --------VNQTIREGQTAFFHC----------VMKHPENSQASWYKDGVLLQEVQDLVRRFYMG 204

  Fly   276 ---TLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDF-------PPMLLIPHQLVGAPEGFN 330
               :|.|......|:|.|.|...|......:.:..:::.:       ||.:.:|:   |.|    
  Fly   205 PDGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPY---GQP---- 262

  Fly   331 VTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVA 395
            ..::|...|:|...|.....:| ::.||  |.|....    ||.:..|....|.....|.|.|..
  Fly   263 AVLDCHFRANPPLKNLRWEKDG-LLFDS--YNVPGVF----YKMNGSLFFAKVDENHAGSYTCTP 320

  Fly   396 KNPRGETDG---IIRLYVSYPP--TTASSGIY 422
            .|..| |||   :|.:.|..||  :.....||
  Fly   321 YNDLG-TDGPSPVISVIVLRPPIFSVTPKAIY 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/126 (21%)
Ig 130..200 CDD:143165 18/88 (20%)
I-set 226..310 CDD:254352 16/94 (17%)
IGc2 233..298 CDD:197706 15/75 (20%)
Ig 313..410 CDD:299845 27/99 (27%)
IG_like 325..410 CDD:214653 23/87 (26%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 21/98 (21%)
Ig 43..131 CDD:299845 20/100 (20%)
I-set 153..242 CDD:254352 18/106 (17%)
Ig 157..242 CDD:299845 17/102 (17%)
Ig_2 252..337 CDD:290606 27/99 (27%)
IG_like 260..327 CDD:214653 20/78 (26%)
I-set 341..428 CDD:254352 3/11 (27%)
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.