DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr2

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:235 Identity:64/235 - (27%)
Similarity:94/235 - (40%) Gaps:46/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 EEPEFTEY---------IENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNP 166
            :.||.|.|         ..|:|...|....:.|.|.|||...|:|:......|||......|.:.
  Fly    96 QPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDE 160

  Fly   167 RISV--THDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVV-PPNIDDSLSS-S 227
            |..|  |.|..|    |.||:......|.|.|.||:||....:....|||:| ||:....::. :
  Fly   161 RFKVVRTADSKD----WTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPT 221

  Fly   228 DVIVREGANISLRC---RASGSPRPI--IKWKRD----------------DNSRIAINKNHIVNE 271
            |:.|:.|::::|.|   :.:.|.:.|  |.|.|.                |..||::...  :.|
  Fly   222 DLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMEST--LAE 284

  Fly   272 WEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVD 311
            .....|.|.....||.|.|.|:      ||.::...|.|:
  Fly   285 KLQSRLRIANAQLLDTGNYTCM------PTTAEAASVVVN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 32/97 (33%)
Ig 130..200 CDD:143165 23/71 (32%)
I-set 226..310 CDD:254352 24/105 (23%)
IGc2 233..298 CDD:197706 19/85 (22%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 30/96 (31%)
Ig 116..192 CDD:299845 25/79 (32%)
ig 220..306 CDD:278476 20/87 (23%)
IG_like 220..306 CDD:214653 20/87 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.