DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr3

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:272 Identity:63/272 - (23%)
Similarity:96/272 - (35%) Gaps:71/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 NVTVPAGR-NVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLH 184
            |:|...|. ...:.|.|.:|....|:|:......||||.....|.:.|..||..|..|.  |.||
  Fly   245 NITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSRE--WTLH 307

  Fly   185 INNVHEEDRGRYMCQINTVTAKTQFGYLNVV-VPPNIDDSLSS-SDVIVREGANISLRCRASGSP 247
            :.....:|.|.|.||:||....:....||:: :.|:....:|. .|:..:.|:.|.|.|...   
  Fly   308 VKAPLAKDSGIYECQVNTEPKMS
MAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILNCLVQ--- 369

  Fly   248 RPIIK------WKR-----------DDNSRIAINK-------------NHIVNEWE--------- 273
            :|.:|      |.|           |....|...:             |.|::|.:         
  Fly   370 QPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRI 434

  Fly   274 ------GDTLE----ITRISRLDMGAYLC-------------IASNGVPPTVSKRIKVSVDFPPM 315
                  ||||:    |:.....|.|.|.|             :.::..|..:.|.........|:
  Fly   435 AMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHV
INDENPAAMQKSGACPCALGPL 499

  Fly   316 LLIPHQLVGAPE 327
            .|:.|.|: .||
  Fly   500 QLLLHLLL-LPE 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/96 (31%)
Ig 130..200 CDD:143165 22/69 (32%)
I-set 226..310 CDD:254352 25/146 (17%)
IGc2 233..298 CDD:197706 22/126 (17%)
Ig 313..410 CDD:299845 6/15 (40%)
IG_like 325..410 CDD:214653 2/3 (67%)
dpr3NP_001014459.2 Ig 243..330 CDD:299845 28/86 (33%)
IG_like 243..329 CDD:214653 28/85 (33%)
Ig 350..464 CDD:299845 22/116 (19%)
IG_like <441..477 CDD:214653 9/35 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.