| Sequence 1: | NP_723441.2 | Gene: | DIP-zeta / 34231 | FlyBaseID: | FBgn0051708 | Length: | 532 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001014459.2 | Gene: | dpr3 / 3346208 | FlyBaseID: | FBgn0053516 | Length: | 522 | Species: | Drosophila melanogaster |
| Alignment Length: | 272 | Identity: | 63/272 - (23%) |
|---|---|---|---|
| Similarity: | 96/272 - (35%) | Gaps: | 71/272 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 121 NVTVPAGR-NVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLH 184
Fly 185 INNVHEEDRGRYMCQINTVTAKTQFGYLNVV-VPPNIDDSLSS-SDVIVREGANISLRCRASGSP 247
Fly 248 RPIIK------WKR-----------DDNSRIAINK-------------NHIVNEWE--------- 273
Fly 274 ------GDTLE----ITRISRLDMGAYLC-------------IASNGVPPTVSKRIKVSVDFPPM 315
Fly 316 LLIPHQLVGAPE 327 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-zeta | NP_723441.2 | IG_like | 120..216 | CDD:214653 | 30/96 (31%) |
| Ig strand B | 130..134 | CDD:409405 | 0/3 (0%) | ||
| Ig strand C | 143..147 | CDD:409405 | 1/3 (33%) | ||
| Ig strand E | 178..185 | CDD:409405 | 2/6 (33%) | ||
| IgI_1_MuSK | 218..310 | CDD:409562 | 27/154 (18%) | ||
| Ig strand A | 218..221 | CDD:409562 | 1/2 (50%) | ||
| Ig strand A' | 226..231 | CDD:409562 | 1/5 (20%) | ||
| Ig strand B | 237..244 | CDD:409562 | 3/6 (50%) | ||
| Ig strand C | 250..255 | CDD:409562 | 2/10 (20%) | ||
| Ig strand C' | 257..259 | CDD:409562 | 0/1 (0%) | ||
| Ig strand D | 267..270 | CDD:409562 | 1/2 (50%) | ||
| Ig strand E | 275..281 | CDD:409562 | 4/9 (44%) | ||
| Ig strand F | 288..295 | CDD:409562 | 3/19 (16%) | ||
| Ig strand G | 302..310 | CDD:409562 | 1/7 (14%) | ||
| IG_like | 325..410 | CDD:214653 | 2/3 (67%) | ||
| Ig strand B | 331..335 | CDD:143207 | |||
| Ig strand C | 344..348 | CDD:143207 | |||
| Ig strand E | 376..380 | CDD:143207 | |||
| Ig strand F | 390..395 | CDD:143207 | |||
| Ig strand G | 403..406 | CDD:143207 | |||
| dpr3 | NP_001014459.2 | IG_like | 243..329 | CDD:214653 | 28/85 (33%) |
| Ig strand B | 255..259 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 269..272 | CDD:409353 | 1/2 (50%) | ||
| Ig strand E | 304..308 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 318..323 | CDD:409353 | 2/4 (50%) | ||
| IG_like | <441..477 | CDD:214653 | 9/35 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||