DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr3

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:272 Identity:63/272 - (23%)
Similarity:96/272 - (35%) Gaps:71/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 NVTVPAGR-NVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLH 184
            |:|...|. ...:.|.|.:|....|:|:......||||.....|.:.|..||..|..|.  |.||
  Fly   245 NITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSRE--WTLH 307

  Fly   185 INNVHEEDRGRYMCQINTVTAKTQFGYLNVV-VPPNIDDSLSS-SDVIVREGANISLRCRASGSP 247
            :.....:|.|.|.||:||....:....||:: :.|:....:|. .|:..:.|:.|.|.|...   
  Fly   308 VKAPLAKDSGIYECQVNTEPKM
SMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILNCLVQ--- 369

  Fly   248 RPIIK------WKR-----------DDNSRIAINK-------------NHIVNEWE--------- 273
            :|.:|      |.|           |....|...:             |.|::|.:         
  Fly   370 QPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRI 434

  Fly   274 ------GDTLE----ITRISRLDMGAYLC-------------IASNGVPPTVSKRIKVSVDFPPM 315
                  ||||:    |:.....|.|.|.|             :.::..|..:.|.........|:
  Fly   435 AMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVINDENPAAMQKSGACPCALGPL 499

  Fly   316 LLIPHQLVGAPE 327
            .|:.|.|: .||
  Fly   500 QLLLHLLL-LPE 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/96 (31%)
Ig strand B 130..134 CDD:409405 0/3 (0%)
Ig strand C 143..147 CDD:409405 1/3 (33%)
Ig strand E 178..185 CDD:409405 2/6 (33%)
IgI_1_MuSK 218..310 CDD:409562 27/154 (18%)
Ig strand A 218..221 CDD:409562 1/2 (50%)
Ig strand A' 226..231 CDD:409562 1/5 (20%)
Ig strand B 237..244 CDD:409562 3/6 (50%)
Ig strand C 250..255 CDD:409562 2/10 (20%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 1/2 (50%)
Ig strand E 275..281 CDD:409562 4/9 (44%)
Ig strand F 288..295 CDD:409562 3/19 (16%)
Ig strand G 302..310 CDD:409562 1/7 (14%)
IG_like 325..410 CDD:214653 2/3 (67%)
Ig strand B 331..335 CDD:143207
Ig strand C 344..348 CDD:143207
Ig strand E 376..380 CDD:143207
Ig strand F 390..395 CDD:143207
Ig strand G 403..406 CDD:143207
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 28/85 (33%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 269..272 CDD:409353 1/2 (50%)
Ig strand E 304..308 CDD:409353 2/3 (67%)
Ig strand F 318..323 CDD:409353 2/4 (50%)
IG_like <441..477 CDD:214653 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.