DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr4

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:250 Identity:70/250 - (28%)
Similarity:106/250 - (42%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 EEPEFTEYIEN-----VTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV 170
            |.|....|.:|     ||...|:...|.|.|:|||...|:|:......||||.....|.:.|...
  Fly    39 ETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQS 103

  Fly   171 THDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGA 235
            .|.:....  |.|.|::....|.|.|.||::|....:|...|||||  :....|.::::.::.|:
  Fly   104 LHSEGSDE--WTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVV--SRAKILGNAELFIKSGS 164

  Fly   236 NISLRCRASGSPRP--IIKW---KRDDN--SRIAINKNHIVNEWEGDT--LEITRISRLDMGAYL 291
            :|:|.|.|..||.|  .|.|   ||..|  .|..||   ::.|....|  |.|.:.:..|.|.|.
  Fly   165 DINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGIN---VITERSTRTSKLLIAKATPADSGNYT 226

  Fly   292 CIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNY 346
            |..|:....:|...: ::.:.|          .|.:..|.:..|......||:.:
  Fly   227 CSPSSSDSASVVVHV-INGEHP----------AAMQHGNSSATCLRPLSSTSVPF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 32/100 (32%)
Ig 130..200 CDD:143165 22/69 (32%)
I-set 226..310 CDD:254352 26/92 (28%)
IGc2 233..298 CDD:197706 25/73 (34%)
Ig 313..410 CDD:299845 6/33 (18%)
IG_like 325..410 CDD:214653 5/21 (24%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 30/94 (32%)
IG_like 53..145 CDD:214653 29/93 (31%)
ig 153..227 CDD:278476 24/76 (32%)
IG_like 161..>227 CDD:214653 23/68 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.