DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and Opcml

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:342 Identity:100/342 - (29%)
Similarity:150/342 - (43%) Gaps:59/342 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAIL 155
            ||.|..|.|..|.:              ::||||..|.:..|.|::.:..: :|||::  :|.||
Mouse    28 GVPVRSGDATFPKA--------------MDNVTVRQGESATLRCTIDDRVT-RVAWLN--RSTIL 75

  Fly   156 TVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVT-AKTQFGYLNVVVPPN 219
            ...|...:.:||:.:..:...::.   :.|.||...|.|.|.|.:.|.. .||...:|.|.|||.
Mouse    76 YAGNDKWSIDPRVIILVNTPTQYS---IMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQ 137

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHI-VNEWEG-----DTLE 278
            |.:  .|||:.|.||::::|.|.|.|.|.|.:.|:            |: |.|.:|     :.||
Mouse   138 IMN--ISSDITVNEGSSVTLLCLAIGRPEPTVTWR------------HLSVKEGQGFVSEDEYLE 188

  Fly   279 ITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTS 343
            |:.|.|...|.|.|.|.|.|.....:::|::|::|| .:...:..|...|....:.|...|.|.:
Mouse   189 ISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPP-YISKAKNTGVSVGQKGILSCEASAVPMA 252

  Fly   344 LNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMK-----LTIINVSSGDDGIYKCVAKNPRGETD 403
            ...|           .|.......||...:...|     ||..|||..|.|.|.|||.|..|.|:
Mouse   253 EFQW-----------FKEDTRLATGLDGVRIENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTN 306

  Fly   404 GIIRLYVSYPPTTASSG 420
            ..|.|| ...|::|.:|
Mouse   307 ASITLY-EISPSSAVAG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 28/96 (29%)
Ig 130..200 CDD:143165 18/69 (26%)
I-set 226..310 CDD:254352 29/89 (33%)
IGc2 233..298 CDD:197706 23/70 (33%)
Ig 313..410 CDD:299845 28/101 (28%)
IG_like 325..410 CDD:214653 25/89 (28%)
OpcmlXP_006510497.1 Ig 44..132 CDD:416386 27/93 (29%)
Ig strand A' 44..49 CDD:409353 4/4 (100%)
Ig strand B 51..59 CDD:409353 2/7 (29%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 3/6 (50%)
Ig strand C 64..70 CDD:409353 3/6 (50%)
CDR2 71..83 CDD:409353 4/11 (36%)
Ig strand C' 72..76 CDD:409353 2/3 (67%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 9/36 (25%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 0/8 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 3/8 (38%)
FR4 125..132 CDD:409353 2/6 (33%)
Ig_3 135..206 CDD:404760 29/84 (35%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 2/8 (25%)
Ig strand C 165..170 CDD:409353 1/4 (25%)
Ig strand C' 171..174 CDD:409353 1/2 (50%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig_3 223..300 CDD:404760 23/88 (26%)
putative Ig strand A 224..230 CDD:409353 1/6 (17%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 1/14 (7%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833592
Domainoid 1 1.000 49 1.000 Domainoid score I11709
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.