DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and Opcml

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:342 Identity:100/342 - (29%)
Similarity:150/342 - (43%) Gaps:59/342 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAIL 155
            ||.|..|.|..|.:              ::||||..|.:..|.|::.:..: :|||::  :|.||
Mouse    28 GVPVRSGDATFPKA--------------MDNVTVRQGESATLRCTIDDRVT-RVAWLN--RSTIL 75

  Fly   156 TVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVT-AKTQFGYLNVVVPPN 219
            ...|...:.:||:.:..:...::.   :.|.||...|.|.|.|.:.|.. .||...:|.|.|||.
Mouse    76 YAGNDKWSIDPRVIILVNTPTQYS---IMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQ 137

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHI-VNEWEG-----DTLE 278
            |.:  .|||:.|.||::::|.|.|.|.|.|.:.|:            |: |.|.:|     :.||
Mouse   138 IMN--ISSDITVNEGSSVTLLCLAIGRPEPTVTWR------------HLSVKEGQGFVSEDEYLE 188

  Fly   279 ITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTS 343
            |:.|.|...|.|.|.|.|.|.....:::|::|::|| .:...:..|...|....:.|...|.|.:
Mouse   189 ISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPP-YISKAKNTGVSVGQKGILSCEASAVPMA 252

  Fly   344 LNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMK-----LTIINVSSGDDGIYKCVAKNPRGETD 403
            ...|           .|.......||...:...|     ||..|||..|.|.|.|||.|..|.|:
Mouse   253 EFQW-----------FKEDTRLATGLDGVRIENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTN 306

  Fly   404 GIIRLYVSYPPTTASSG 420
            ..|.|| ...|::|.:|
Mouse   307 ASITLY-EISPSSAVAG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 28/96 (29%)
Ig strand B 130..134 CDD:409405 1/3 (33%)
Ig strand C 143..147 CDD:409405 2/3 (67%)
Ig strand E 178..185 CDD:409405 0/6 (0%)
IgI_1_MuSK 218..310 CDD:409562 31/97 (32%)
Ig strand A 218..221 CDD:409562 1/2 (50%)
Ig strand A' 226..231 CDD:409562 3/4 (75%)
Ig strand B 237..244 CDD:409562 2/6 (33%)
Ig strand C 250..255 CDD:409562 1/4 (25%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 1/3 (33%)
Ig strand E 275..281 CDD:409562 3/5 (60%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 1/7 (14%)
IG_like 325..410 CDD:214653 25/89 (28%)
Ig strand B 331..335 CDD:143207 0/3 (0%)
Ig strand C 344..348 CDD:143207 0/3 (0%)
Ig strand E 376..380 CDD:143207 2/8 (25%)
Ig strand F 390..395 CDD:143207 2/4 (50%)
Ig strand G 403..406 CDD:143207 0/2 (0%)
OpcmlXP_006510497.1 Ig 44..132 CDD:472250 27/93 (29%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 2/3 (67%)
Ig strand E 98..102 CDD:409353 0/6 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 135..206 CDD:464046 29/84 (35%)
Ig 224..312 CDD:472250 26/99 (26%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 1/14 (7%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.