DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and CG15312

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster


Alignment Length:371 Identity:76/371 - (20%)
Similarity:122/371 - (32%) Gaps:115/371 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 YMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSR 260
            :..|:.||.:.|                :..::....:|.|:|:.|.|.|:    |.|.::..  
  Fly    18 FFTQVLTVLSST----------------IKYNEYATDKGGNVSIPCIAQGN----IMWVKEHG-- 60

  Fly   261 IAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLV-- 323
               |.:.||.  .|..|.:..:|..|.|.|:|.||...|.|.:.....|         |..|.  
  Fly    61 ---NNSTIVQ--TGRVLVLRNVSTTDAGIYVCFASVPRPSTTATSATTS---------PQNLQDK 111

  Fly   324 ----------GAPEGFNVTIECFTEAH-PTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMK 377
                      |..|..:...:...||. ...:.|       :.|...|..|....| |..:.:.|
  Fly   112 ETRPLEDEDDGQGESVSPKDDQLKEAEMEEEVEY-------LAHQRTKLIVRTVPG-PVSQLYFK 168

  Fly   378 LTII---------NVSSGDDGIYKCVAKNPRGETDGIIRLYVSY--PPTTASSGIYSTDTHWGE- 430
            .:.|         ...||...:....|:...          |||  ||..|     |.:..|.. 
  Fly   169 ASTILGFLIWRFNKTQSGGYPVRSFTAEYRN----------VSYKTPPANA-----SFEHAWSRM 218

  Fly   431 NGINNNYAYGGPDSTR--SIYAQDKNTRYQSNL---NEIGLSE----QKSFLDKTQNPLLANGNA 486
            :.||..:      :.|  .:|....||.|:..:   ||:|..|    ..:.|.:|:...|.....
  Fly   219 DPINIAF------NVRQMEVYRLAPNTTYEFRIWANNELGSGEVVTTNVTTLPETKEEDLIRLIK 277

  Fly   487 NEADAESNGARGHNPSMAIAWLFVVIATLLLTIRSAVGSSHSLSLC 532
            .:.|       ..:|.:.|..:.:|:.||::.   |:|      ||
  Fly   278 PDLD-------NFDPRIWIVAVSIVLGTLVIL---AIG------LC 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 4/19 (21%)
Ig strand B 130..134 CDD:409405
Ig strand C 143..147 CDD:409405
Ig strand E 178..185 CDD:409405
IgI_1_MuSK 218..310 CDD:409562 22/91 (24%)
Ig strand A 218..221 CDD:409562 0/2 (0%)
Ig strand A' 226..231 CDD:409562 0/4 (0%)
Ig strand B 237..244 CDD:409562 2/6 (33%)
Ig strand C 250..255 CDD:409562 2/4 (50%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 1/2 (50%)
Ig strand E 275..281 CDD:409562 1/5 (20%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 0/7 (0%)
IG_like 325..410 CDD:214653 14/94 (15%)
Ig strand B 331..335 CDD:143207 0/3 (0%)
Ig strand C 344..348 CDD:143207 1/3 (33%)
Ig strand E 376..380 CDD:143207 1/3 (33%)
Ig strand F 390..395 CDD:143207 0/4 (0%)
Ig strand G 403..406 CDD:143207 0/2 (0%)
CG15312NP_001245603.1 Ig 39..90 CDD:472250 18/61 (30%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 1/7 (14%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.