DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and Fas2

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:477 Identity:111/477 - (23%)
Similarity:174/477 - (36%) Gaps:135/477 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VVGSNGVIVAGGGANVPTSNLNI------VVE---------------EPEFTEYIENVTVPAGRN 129
            ||.:||:::    .||..|:..|      |:|               :||......|:....|:.
  Fly   186 VVQTNGLLI----RNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKP 246

  Fly   130 VKLGCSVKNLGSYKVAWMH-FEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDR 193
            ....|:.:.....:::|:. ..|..:.|.....:  ||            :|..:.|::|.::|.
  Fly   247 FAANCTARGKPVPEISWIRDATQLNVATADRFQV--NP------------QTGLVTISSVSQDDY 297

  Fly   194 GRYMC----QINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWK 254
            |.|.|    :...|..||:   |||:|.|.|.:..:.:....:|   |::.|||.|.|.|.|.::
  Fly   298 GTYTCLAKNRAGVVDQKTK---LNVLVRPQIYELYNVTGARTKE---IAITCRAKGRPAPAITFR 356

  Fly   255 R------------DDNSRIAINKNHIVNEWEGD---TLEITRISRLDMGAYLCIASN-GVPPTVS 303
            |            ||:.||.:..|  .:|..|:   ||.|:...|.|.|.|.|||.| |.....:
  Fly   357 RWGTQEEYTNGQQDDDPRIILEPN--FDEERGESTGTLRISNAERSDDGLYQCIARNKGADAYKT 419

  Fly   304 KRIKV--SVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEAT 366
            ..|.|  :.||..|..:|.  |.:.|.....:.|.....|.:...| ...|..|.|         
  Fly   420 GHITVEFAPDFSHMKELPP--VFSWEQRKANLSCLAMGIPNATIEW-HWNGRKIKD--------- 472

  Fly   367 VGLPAYKTHMKLTIINVSSGDDGI-----------YKCVAKNPRGETDGIIRLYVSYPP------ 414
                .|.|::|  |:......|.|           |||:|.|..|..:..::|..:..|      
  Fly   473 ----LYDTNLK--IVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEA 531

  Fly   415 -------TTASSGIYSTDTHWG----------ENGINNNY--AYG---GPDSTRSIYAQDKNTRY 457
                   ||.:..|....|..|          :..:|.::  ||.   .|||...:......|.|
  Fly   532 KPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAYNRSWSPDSPYIVEGLRPQTEY 596

  Fly   458 --------QSNLNEIGLSEQKS 471
                    |..|...|:::|:|
  Fly   597 SFRFAARNQVGLGNWGVNQQQS 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 21/100 (21%)
Ig 130..200 CDD:143165 13/74 (18%)
I-set 226..310 CDD:254352 31/101 (31%)
IGc2 233..298 CDD:197706 28/80 (35%)
Ig 313..410 CDD:299845 23/107 (21%)
IG_like 325..410 CDD:214653 20/95 (21%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 10/43 (23%)
IGc2 152..209 CDD:197706 8/26 (31%)
I-set 230..319 CDD:254352 21/105 (20%)
IGc2 243..309 CDD:197706 14/79 (18%)
IG_like 330..424 CDD:214653 30/98 (31%)
IGc2 339..412 CDD:197706 26/74 (35%)
Ig 447..518 CDD:143165 18/86 (21%)
fn3 534..611 CDD:278470 15/76 (20%)
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.