DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and ttn-1

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001346715.1 Gene:ttn-1 / 266969 WormBaseID:WBGene00006436 Length:15188 Species:Caenorhabditis elegans


Alignment Length:349 Identity:87/349 - (24%)
Similarity:135/349 - (38%) Gaps:68/349 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VGSNGVIVAGGGANVPTSNLNIVVEE----PEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWM 147
            ||.|..     |.....:.|.:|:.:    |.|.:.:.:|.......:||..:::...:.::.|.
 Worm 13098 VGKNAF-----GECESEAKLTVVIPDGQYAPSFGKQLSDVKCSESDILKLEVNIQANPAPEINWF 13157

  Fly   148 HFEQSAILTVHNHVITRNPRISVTHDKHDRHR------TWYLHINNVHEEDRGRYMCQINTVTAK 206
            ..|.                 .:.|.:|.|.:      .:.|.|.:.:.||.|.|.|     .||
 Worm 13158 RNES-----------------EIEHSQHHRLQFDDGSGNYSLTIIDAYAEDSGEYKC-----VAK 13200

  Fly   207 TQFGYLNVVVPPNIDDSLSS-SDVI-----------------VREGANISLRCRASGSPRPIIKW 253
            .:.|..:.|....|::.||. |..|                 |.:||:::|.|..||:|.|.|||
 Worm 13201 NKIGKAHTVCCVRIEELLSKRSKKIDGSKAPRFRMQLPTPREVPQGADLTLVCSVSGTPHPNIKW 13265

  Fly   254 KRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASN--GVPPTVS-KRIKVSVD---F 312
            .:||.. |.::...:.:|....||.|......|.|.|:|.|.|  ||..:.| ..||.:||   .
 Worm 13266 TKDDKP-IDMSNKQVRHENGVCTLHIIGARDDDQGRYVCEAENIHGVAQSFSVVEIKEAVDKDHV 13329

  Fly   313 PPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMK 377
            .|..|.|.......||..:.:||.....|.....|.:....:|.::...:.....|:      .:
 Worm 13330 RPKFLEPLVNCSTCEGNEMVLECCVTGKPIPTITWYKDGLKLIIENRMLQYTDRKGV------SR 13388

  Fly   378 LTIINVSSGDDGIYKCVAKNPRGE 401
            |.|:||...|||.|.|.|.|..|:
 Worm 13389 LNIMNVVMNDDGEYTCEAVNSLGK 13412

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 18/101 (18%)
Ig strand B 130..134 CDD:409405 2/3 (67%)
Ig strand C 143..147 CDD:409405 0/3 (0%)
Ig strand E 178..185 CDD:409405 1/12 (8%)
IgI_1_MuSK 218..310 CDD:409562 35/112 (31%)
Ig strand A 218..221 CDD:409562 0/2 (0%)
Ig strand A' 226..231 CDD:409562 2/22 (9%)
Ig strand B 237..244 CDD:409562 2/6 (33%)
Ig strand C 250..255 CDD:409562 3/4 (75%)
Ig strand C' 257..259 CDD:409562 1/1 (100%)
Ig strand D 267..270 CDD:409562 0/2 (0%)
Ig strand E 275..281 CDD:409562 3/5 (60%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 3/8 (38%)
IG_like 325..410 CDD:214653 20/77 (26%)
Ig strand B 331..335 CDD:143207 0/3 (0%)
Ig strand C 344..348 CDD:143207 0/3 (0%)
Ig strand E 376..380 CDD:143207 1/3 (33%)
Ig strand F 390..395 CDD:143207 2/4 (50%)
Ig strand G 403..406 CDD:143207
ttn-1NP_001346715.1 IG_like 105..177 CDD:214653
Ig strand B 107..111 CDD:409353
Ig strand C 120..124 CDD:409353
Ig strand E 146..150 CDD:409353
Ig strand F 157..162 CDD:409353
Ig_3 205..280 CDD:464046
Ig 406..493 CDD:472250
Ig strand B 424..428 CDD:409353
Ig strand C 437..441 CDD:409353
Ig strand E 462..466 CDD:409353
Ig strand F 474..479 CDD:409353
Ig strand G 487..490 CDD:409353
Ig 821..914 CDD:472250
Ig strand B 838..842 CDD:409353
Ig strand C 851..855 CDD:409353
Ig strand E 880..884 CDD:409353
Ig strand F 894..899 CDD:409353
Ig strand G 907..910 CDD:409353
Ig 962..1030 CDD:409353
Ig strand B 962..966 CDD:409353
Ig strand C 975..979 CDD:409353
Ig strand E 1000..1005 CDD:409353
Ig strand F 1015..1020 CDD:409353
Ig 1135..1215 CDD:472250
Ig strand B 1152..1156 CDD:409353
Ig strand C 1165..1169 CDD:409353
Ig strand E 1190..1194 CDD:409353
Ig strand F 1204..1209 CDD:409353
Ig strand G 1217..1220 CDD:409353
I-set 1679..1767 CDD:400151
Ig strand B 1696..1700 CDD:409353
Ig strand C 1709..1713 CDD:409353
Ig strand E 1734..1738 CDD:409353
Ig strand F 1748..1753 CDD:409353
IG_like 1789..>1844 CDD:214653
Ig strand B 1789..1793 CDD:409353
Ig strand C 1801..1805 CDD:409353
Ig strand E 1829..1833 CDD:409353
Ig strand F 1843..1847 CDD:409353
Ig strand G 1856..1859 CDD:409353
PHA03247 <1957..2285 CDD:223021
Ig 2381..2468 CDD:472250
Ig strand B 2398..2402 CDD:409353
Ig strand C 2411..2415 CDD:409353
Ig strand E 2437..2441 CDD:409353
Ig strand F 2451..2456 CDD:409353
Ig strand G 2464..2467 CDD:409353
Ig 2489..2578 CDD:472250
Ig strand B 2507..2511 CDD:409353
Ig strand C 2520..2524 CDD:409353
Ig strand E 2544..2548 CDD:409353
Ig strand F 2558..2563 CDD:409353
Ig strand G 2573..2576 CDD:409353
Ig 2631..2717 CDD:472250
Ig strand B 2647..2651 CDD:409353
Ig strand C 2660..2664 CDD:409353
Ig strand E 2685..2689 CDD:409353
Ig strand F 2698..2703 CDD:409353
Ig strand G 2711..2714 CDD:409353
Ig 2749..2806 CDD:472250
Ig strand B 2749..2752 CDD:409353
Ig strand C 2761..2765 CDD:409353
Ig strand E 2784..2787 CDD:409353
Ig strand F 2795..2800 CDD:409353
Ig strand B 2836..2846 CDD:409353
Ig <2848..2913 CDD:472250
Ig strand C 2855..2859 CDD:409353
Ig strand E 2877..2881 CDD:409353
Ig strand F 2893..2898 CDD:409353
Ig strand G 2906..2909 CDD:409353
Ig 2924..3007 CDD:472250
rne <3161..3303 CDD:236766
rne <3356..3556 CDD:236766
rne <3506..3673 CDD:236766
rne <3595..3803 CDD:236766
rne <3722..3912 CDD:236766
rne <3875..4073 CDD:236766
PRK10263 <4014..>4556 CDD:236669
rne <4346..4567 CDD:236766
rne <4525..4723 CDD:236766
rne <4746..4936 CDD:236766
rne <4858..5044 CDD:236766
PRK10263 <4960..>5541 CDD:236669
PTZ00121 <5525..6250 CDD:173412
PTZ00121 <6198..6681 CDD:173412
tolA <6559..>6683 CDD:236545
Ig 7448..7535 CDD:472250
Ig strand B 7466..7470 CDD:319246
Ig strand C 7479..7483 CDD:319246
Ig strand E 7502..7506 CDD:319246
FN3 <7516..7762 CDD:442628
Ig strand F 7516..7521 CDD:319246
Ig strand G 7529..7532 CDD:319246
FN3 7540..7630 CDD:238020
PTZ00121 <7944..8780 CDD:173412
Ig 8875..>8935 CDD:472250
Ig strand B 8884..8887 CDD:409353
Ig strand C 8895..8899 CDD:409353
Ig strand E 8921..8925 CDD:409353
FN3 9052..9142 CDD:238020
PTZ00121 <9210..9875 CDD:173412
PTZ00121 <9583..10392 CDD:173412
IG_like 10597..>10662 CDD:214653
Ig strand B 10608..10612 CDD:409353
Ig strand C 10622..10626 CDD:409353
Ig strand E 10647..10651 CDD:409353
Ig strand F 10661..10666 CDD:409353
Ig strand G 10670..10673 CDD:409353
Ig <10711..10773 CDD:472250
Ig strand C 10712..10716 CDD:409353
Ig strand E 10739..10743 CDD:409353
Ig strand F 10753..10758 CDD:409353
FN3 <10754..>10967 CDD:442628
Ig strand G 10766..10769 CDD:409353
FN3 10984..11070 CDD:238020
Ig 11077..11165 CDD:472250
Ig strand B 11094..11098 CDD:409353
Ig strand C 11107..11111 CDD:409353
Ig strand E 11133..11137 CDD:409353
Ig strand F 11147..11152 CDD:409353
Ig strand G 11160..11163 CDD:409353
Ig 11183..11254 CDD:472250
Ig strand B 11190..11194 CDD:409353
Ig strand C 11202..11206 CDD:409353
Ig strand E 11227..11231 CDD:409353
Ig strand F 11241..11246 CDD:409353
Ig strand G 11250..11253 CDD:409353
Ig 11264..11350 CDD:472250
Ig strand B 11282..11286 CDD:409353
Ig strand C 11294..11298 CDD:409353
Ig strand E 11317..11324 CDD:409353
Ig strand G 11345..11348 CDD:409353
Ig 11368..11446 CDD:472250
FN3 <11450..>11657 CDD:442628
Ig 11823..11903 CDD:472250
Ig 11918..11996 CDD:472250
Ig strand B 11926..11930 CDD:409353
Ig strand C 11938..11942 CDD:409353
Ig strand E 11963..11968 CDD:409353
Ig strand F 11978..11983 CDD:409353
FN3 <11979..12306 CDD:442628
Ig strand G 11991..11994 CDD:409353
Ig 12335..12411 CDD:472250
Ig strand B 12338..12342 CDD:409353
Ig strand C 12351..12356 CDD:409353
Ig strand E 12377..12381 CDD:409353
Ig strand F 12391..12396 CDD:409353
Ig strand G 12404..12407 CDD:409353
FN3 12415..12503 CDD:238020
Protein Kinases, catalytic domain 12566..12815 CDD:473864
I-set 12894..12985 CDD:400151
Ig strand B 12912..12916 CDD:409353
Ig strand C 12925..12929 CDD:409353
Ig strand E 12951..12955 CDD:409353
Ig strand F 12965..12970 CDD:409353
Ig 13024..13114 CDD:472250 5/20 (25%)
Ig strand B 13041..13045 CDD:409353
Ig strand C 13054..13058 CDD:409353
Ig strand E 13080..13084 CDD:409353