Sequence 1: | NP_723441.2 | Gene: | DIP-zeta / 34231 | FlyBaseID: | FBgn0051708 | Length: | 532 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510069.1 | Gene: | zig-2 / 192087 | WormBaseID: | WBGene00006979 | Length: | 238 | Species: | Caenorhabditis elegans |
Alignment Length: | 236 | Identity: | 61/236 - (25%) |
---|---|---|---|
Similarity: | 92/236 - (38%) | Gaps: | 65/236 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 218 PNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRI 282
Fly 283 SRLDM---------------GAYLCIASNGVPPT--VSK------------------RIKVSVDF 312
Fly 313 PPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNY-WTRGEGPIIHDSHKYKVEATVGLPAYKTHM 376
Fly 377 KLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTA 417 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-zeta | NP_723441.2 | IG_like | 120..216 | CDD:214653 | |
Ig | 130..200 | CDD:143165 | |||
I-set | 226..310 | CDD:254352 | 26/118 (22%) | ||
IGc2 | 233..298 | CDD:197706 | 20/79 (25%) | ||
Ig | 313..410 | CDD:299845 | 27/97 (28%) | ||
IG_like | 325..410 | CDD:214653 | 25/85 (29%) | ||
zig-2 | NP_510069.1 | I-set | 34..134 | CDD:254352 | 25/102 (25%) |
Ig | 34..121 | CDD:299845 | 21/89 (24%) | ||
Ig | <179..232 | CDD:299845 | 20/61 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |