DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and zig-11

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_503523.2 Gene:zig-11 / 189580 WormBaseID:WBGene00021305 Length:304 Species:Caenorhabditis elegans


Alignment Length:268 Identity:64/268 - (23%)
Similarity:94/268 - (35%) Gaps:75/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GSTVVGSN--GVIVA-GGGANVPTS-------NLNIVVE-EPEFTEYIENVTVPAGRNVKLGCSV 136
            |:||:.:.  .||:| ...::..||       ||..|:. |..|:..|:......|   .|.|.|
 Worm     3 GTTVLAATTLAVILALYAPSDAATSQKYTAMGNLQTVIHGESLFSTDIDENRKTTG---VLWCQV 64

  Fly   137 KNLGS--YKVAWMHFEQSAILTVHNHVITRNPR-----ISVTHDKHDRHRTWYLHINNVHEEDRG 194
            :. |:  ||..|..|           |..|:.:     |.:..||.      |||......:..|
 Worm    65 RE-GTIHYKPTWARF-----------VRIRDQKQFRADIGLDDDKA------YLHFGQSKADASG 111

  Fly   195 RYMCQI----NTVTAKTQFGYLNVVVPPNIDDSLSSSD----------VIVREGANISLRCRASG 245
            :|.|:|    |::.....|.|.:.||..|....|..|:          |.....:...::|...|
 Worm   112 KYRCEIKVPDNSIIIGNMFAYSHPVVKNNETWELKKSESEPFTVVGPAVYAPLDSAARIQCPIVG 176

  Fly   246 SPRPIIKWKRDD-----NSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKR 305
            .|.|.|.|.:|.     ..|:         ::....|.|......|.|.|.|.|:|..|      
 Worm   177 YPEPQIVWYKDKFPLEIEGRV---------KFTAGVLSIEGAQEEDAGVYRCEATNQFP------ 226

  Fly   306 IKVSVDFP 313
              |.:|.|
 Worm   227 --VQIDGP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/106 (23%)
Ig 130..200 CDD:143165 19/76 (25%)
I-set 226..310 CDD:254352 20/98 (20%)
IGc2 233..298 CDD:197706 16/69 (23%)
Ig 313..410 CDD:299845 1/1 (100%)
IG_like 325..410 CDD:214653
zig-11NP_503523.2 IGc2 165..223 CDD:197706 15/66 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.