DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and zig-4

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:325 Identity:68/325 - (20%)
Similarity:93/325 - (28%) Gaps:145/325 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 MHFE-QSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFG 210
            ||.| .||::|:.|.:.|.                 ||                  |..||    
 Worm    20 MHAEMHSAVVTLANEIDTN-----------------YL------------------TSPAK---- 45

  Fly   211 YLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWE-- 273
             :.:|.|      |.|:  ::..|....|||....:|...|.||  .|.::....|.:..|.:  
 Worm    46 -IKIVAP------LESA--LIPGGETYQLRCDIMSTPAATIHWK--FNGKLIQGSNELNVEEKLL 99

  Fly   274 --GDTLEITRI----------SRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAP 326
              |..:..|.|          |..:.|.|.|:..||                      ||     
 Worm   100 NFGKAIVDTGIVASILTIQCPSAENSGTYSCVGYNG----------------------HQ----- 137

  Fly   327 EGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVE---------------ATVGLPA----- 371
                 |||...|..       ..||......:||...|               ||:...|     
 Worm   138 -----TIETVAEVE-------IEGEASGCRSNHKSAPEIVFWTDSRFEMTGNVATLVCRANQQVD 190

  Fly   372 ---------YKTHMKLTII--------NVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASS 419
                     .|.:.|.|::        |:...|.|.|.|:|:|..||......||    ||...|
 Worm   191 WVWMSNDELVKNNDKFTVLSNGDLVIKNIVWDDMGTYTCIARNQFGEARQETFLY----PTAKKS 251

  Fly   420  419
             Worm   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 13/69 (19%)
Ig 130..200 CDD:143165 10/53 (19%)
I-set 226..310 CDD:254352 21/97 (22%)
IGc2 233..298 CDD:197706 19/78 (24%)
Ig 313..410 CDD:299845 27/133 (20%)
IG_like 325..410 CDD:214653 25/121 (21%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 30/148 (20%)
Ig 65..144 CDD:143165 24/112 (21%)
IG_like 176..245 CDD:214653 15/68 (22%)
Ig <193..238 CDD:299845 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.