DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and zig-8

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:209 Identity:55/209 - (26%)
Similarity:83/209 - (39%) Gaps:49/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV 170
            :|:|.|.|.:                |.|||.....:::||......|:||..|...||:||..|
 Worm    45 VNVVAENPAY----------------LHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQV 93

  Fly   171 THDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREG- 234
            :....:   .|.|::....::|.|.|:|:||.........||.|:.||     |.|...:.::. 
 Worm    94 SKKSAN---IWVLNLRRAEQQDSGCYLCEINDKHNTVYAVYLKVLEPP-----LPSPSSLQKKST 150

  Fly   235 ---ANIS-----LRCRASGSPRP----IIKWKRDDNSRIAINKNHI------VNEWEGDTLEITR 281
               ||:|     |.|..:.:.:.    .:.|.||.|:   ||.|..      |....|..:|..|
 Worm   151 KLMANMSGDEVVLNCTVTSTDKDEEVLDVVWTRDGNT---INFNDTEKYILKVKRDAGVVIETMR 212

  Fly   282 ISRLDM---GAYLC 292
            |.:..|   |.|.|
 Worm   213 IRKATMEDDGNYAC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 26/95 (27%)
Ig 130..200 CDD:143165 21/69 (30%)
I-set 226..310 CDD:254352 22/89 (25%)
IGc2 233..298 CDD:197706 21/82 (26%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
zig-8NP_499714.1 IG_like 55..134 CDD:214653 25/81 (31%)
Ig 55..129 CDD:143165 23/76 (30%)
ig 158..229 CDD:278476 18/72 (25%)
IG_like 158..227 CDD:214653 18/72 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.