Sequence 1: | NP_723441.2 | Gene: | DIP-zeta / 34231 | FlyBaseID: | FBgn0051708 | Length: | 532 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_499714.1 | Gene: | zig-8 / 176732 | WormBaseID: | WBGene00006985 | Length: | 268 | Species: | Caenorhabditis elegans |
Alignment Length: | 209 | Identity: | 55/209 - (26%) |
---|---|---|---|
Similarity: | 83/209 - (39%) | Gaps: | 49/209 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 LNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV 170
Fly 171 THDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREG- 234
Fly 235 ---ANIS-----LRCRASGSPRP----IIKWKRDDNSRIAINKNHI------VNEWEGDTLEITR 281
Fly 282 ISRLDM---GAYLC 292 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-zeta | NP_723441.2 | IG_like | 120..216 | CDD:214653 | 26/95 (27%) |
Ig | 130..200 | CDD:143165 | 21/69 (30%) | ||
I-set | 226..310 | CDD:254352 | 22/89 (25%) | ||
IGc2 | 233..298 | CDD:197706 | 21/82 (26%) | ||
Ig | 313..410 | CDD:299845 | |||
IG_like | 325..410 | CDD:214653 | |||
zig-8 | NP_499714.1 | IG_like | 55..134 | CDD:214653 | 25/81 (31%) |
Ig | 55..129 | CDD:143165 | 23/76 (30%) | ||
ig | 158..229 | CDD:278476 | 18/72 (25%) | ||
IG_like | 158..227 | CDD:214653 | 18/72 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |