DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and zig-7

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_491451.2 Gene:zig-7 / 172096 WormBaseID:WBGene00006984 Length:239 Species:Caenorhabditis elegans


Alignment Length:236 Identity:59/236 - (25%)
Similarity:98/236 - (41%) Gaps:49/236 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SNLNIVVEEPEFTEYIENVTVPAGRNVK-LGCSVKNLGSY-KVAWMHFEQSAILTVHNHVITRNP 166
            ||| .||..||......|.|:.|  |:: |.|..:|||.: .|.:..|.:.:...|....:.:. 
 Worm    27 SNL-AVVGSPESHVGTPNKTLYA--NIQNLWCGAQNLGEHIDVEYGEFTRLSDGKVFKGTVNQG- 87

  Fly   167 RISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNID--DSLSSSDV 229
                         ..||.|.....:..|||.|::.|:..:...|.|.:.:||.:|  .::..|:|
 Worm    88 -------------KVYLEIGKASVKVAGRYRCEVRTLDKEIHSGNLIIYMPPVLDFPAAVRVSEV 139

  Fly   230 IVR-------------EGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITR 281
            :..             .|..:.|.|....:|.|:::|::  |.....|.:.|  |::|:.|.:..
 Worm   140 LNARPPHVIGAERRGLHGERMVLECPVLANPEPMVRWEK--NGEPLGNSDSI--EYDGNNLILNS 200

  Fly   282 ISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQL 322
            ::...:|.|.||..|..|        :.||.|   .||||:
 Worm   201 LTEDHIGKYRCIGDNSFP--------LFVDGP---AIPHQI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/97 (23%)
Ig 130..200 CDD:143165 15/71 (21%)
I-set 226..310 CDD:254352 20/96 (21%)
IGc2 233..298 CDD:197706 17/64 (27%)
Ig 313..410 CDD:299845 5/10 (50%)
IG_like 325..410 CDD:214653
zig-7NP_491451.2 IGc2 157..216 CDD:197706 16/62 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.