DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and pigrl4.2

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001293038.1 Gene:pigrl4.2 / 105665605 ZFINID:ZDB-GENE-150409-10 Length:240 Species:Danio rerio


Alignment Length:211 Identity:48/211 - (22%)
Similarity:76/211 - (36%) Gaps:67/211 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 ENVTVP--------------AGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV 170
            |.:|:|              ...|..|||||....::...|              .||..|    
Zfish    32 ETITIPCLYDNKYKLNKKYWCNGNTWLGCSVVAYANHTGKW--------------TITDYP---- 78

  Fly   171 THDKHDRHRTWYLHINNVHEEDRGRYMC--QINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVRE 233
                  .|..:.:.:||....|.|.|.|  :|:.....:::.||.|...|::  |:.||.|...:
Zfish    79 ------DHNMFTVTLNNSTSSDSGHYWCAVEIDHHVDNSKYLYLTVQKAPDV--SVLSSSVSGHK 135

  Fly   234 GANISLRC-RASGSPRPIIKWKRDD--------------NSRIAINKNHIVNEWEGD---TLEIT 280
            |.::|:|| ..|.....:.:|.|.|              ||.:.|:.       :|:   |:.:|
Zfish   136 GDDVSVRCFYRSAYQNKLKQWCRIDDLTCFREKKTDTSQNSSVQISD-------DGESSFTVLMT 193

  Fly   281 RISRLDMGAYLCIASN 296
            .:...|.|.|.|...|
Zfish   194 GLRLSDSGWYFCSVGN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/111 (22%)
Ig 130..200 CDD:143165 16/71 (23%)
I-set 226..310 CDD:254352 22/89 (25%)
IGc2 233..298 CDD:197706 19/82 (23%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
pigrl4.2NP_001293038.1 IG_like 26..118 CDD:214653 23/109 (21%)
Ig_pIgR 30..117 CDD:143193 22/108 (20%)
Ig 133..217 CDD:299845 19/84 (23%)
IG_like 136..218 CDD:214653 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.