DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and havcr2

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_003200921.2 Gene:havcr2 / 100536120 ZFINID:ZDB-GENE-091204-20 Length:231 Species:Danio rerio


Alignment Length:113 Identity:26/113 - (23%)
Similarity:43/113 - (38%) Gaps:34/113 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 HQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVS 384
            ||.:.:.|...::|:      ...|||         .:||::.:::  ||.  :..:.|||..|.
Zfish    53 HQSLFSCENTVISID------GLQLNY---------RESHRFSLDS--GLD--RGDVSLTIRAVQ 98

  Fly   385 SGDDGIYKCVAKNPRGETDGIIRLYV---------------SYPPTTA 417
            ..|.|:|.|..:.|....|....:|:               ...||||
Zfish    99 KSDAGMYVCRIEIPGLFNDISYNVYLFIRSGLDPKRVVSETQLAPTTA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653
Ig strand B 130..134 CDD:409405
Ig strand C 143..147 CDD:409405
Ig strand E 178..185 CDD:409405
IgI_1_MuSK 218..310 CDD:409562
Ig strand A 218..221 CDD:409562
Ig strand A' 226..231 CDD:409562
Ig strand B 237..244 CDD:409562
Ig strand C 250..255 CDD:409562
Ig strand C' 257..259 CDD:409562
Ig strand D 267..270 CDD:409562
Ig strand E 275..281 CDD:409562
Ig strand F 288..295 CDD:409562
Ig strand G 302..310 CDD:409562
IG_like 325..410 CDD:214653 19/84 (23%)
Ig strand B 331..335 CDD:143207 1/3 (33%)
Ig strand C 344..348 CDD:143207 3/3 (100%)
Ig strand E 376..380 CDD:143207 1/3 (33%)
Ig strand F 390..395 CDD:143207 2/4 (50%)
Ig strand G 403..406 CDD:143207 1/2 (50%)
havcr2XP_003200921.2 Ig 24..126 CDD:472250 22/91 (24%)
Ig strand B 32..36 CDD:409574
Ig strand C 47..51 CDD:409574
Ig strand E 90..94 CDD:409574 1/3 (33%)
Ig strand F 104..109 CDD:409574 2/4 (50%)
Ig strand G 119..122 CDD:409574 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.