DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and hmcn2

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_031747766.1 Gene:hmcn2 / 100490941 XenbaseID:XB-GENE-6034990 Length:4625 Species:Xenopus tropicalis


Alignment Length:469 Identity:118/469 - (25%)
Similarity:169/469 - (36%) Gaps:103/469 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 AGGG-ANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVH 158
            |||| |....|    |.:.|.......|:|...|.:..|.|.|.....|.:.|.|..::      
 Frog   492 AGGGYARTKVS----VADPPPTLAVTHNITTFVGGSAILSCEVLGEIRYNLTWAHSGKA------ 546

  Fly   159 NHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFG------YLNVVVP 217
                .|..|:.:..:..       |.|.|....|.|.|.|     ||....|      :|.:..|
 Frog   547 ----FREGRVRILANSS-------LEILNAQASDAGEYQC-----TASNDHGATTASLWLTIQAP 595

  Fly   218 PNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDN-----SRIAINKNHIVNEWEGDTL 277
            |:|:  :.||.:.:..|..::|||..||:|.|.:.||.:|:     ||..:..|        .||
 Frog   596 PSIE--IKSSSMQLSHGEEVTLRCDVSGNPVPQVSWKHEDSFLSNGSRYTVLDN--------STL 650

  Fly   278 EITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPT 342
            .|....:.|.|.|.|:|||.:...........|:.|....: ..||..|.|.:..:||.:|..|.
 Frog   651 LIKDAGQEDAGNYSCVASNSLGTDEQTVFLTYVERPKATAV-KALVLVPLGEDAILECLSEGLPP 714

  Fly   343 SLNYWTRGEGPIIHDSHKYKVEATV-GLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGII 406
            .:..|             ||.:..| |..:......|.:..|.:.|.|.|.|||.|..|....||
 Frog   715 PVVTW-------------YKDDKEVTGTESGTNGGTLKLQEVRAEDGGKYACVASNNAGTASDII 766

  Fly   407 RLYVSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGLSEQKS 471
            ::.|..||......: ..:...|::......|.|.|....|.:.||:.....|...||       
 Frog   767 QVDVGTPPQFIDFPL-DVEVEVGDSASLPCSAEGNPTPQVSWFRQDEGPVVPSGTTEI------- 823

  Fly   472 FLDKTQNPLLANGN------ANEADAESNGARGHNPSMAIAWLFVVIATLLLTI------RSAVG 524
                .:.|   ..|      |...||........|   |..|   |.|.:||::      :.||.
 Frog   824 ----IEGP---GSNTVHFKVARPEDAAVYVCEARN---AFGW---VQAEILLSVTGLAAPKLAVA 875

  Fly   525 SS-------HSLSL 531
            ||       ||::|
 Frog   876 SSEVTVLEGHSVTL 889

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/101 (22%)
Ig strand B 130..134 CDD:409405 1/3 (33%)
Ig strand C 143..147 CDD:409405 0/3 (0%)
Ig strand E 178..185 CDD:409405 1/6 (17%)
IgI_1_MuSK 218..310 CDD:409562 28/96 (29%)
Ig strand A 218..221 CDD:409562 1/2 (50%)
Ig strand A' 226..231 CDD:409562 2/4 (50%)
Ig strand B 237..244 CDD:409562 3/6 (50%)
Ig strand C 250..255 CDD:409562 1/4 (25%)
Ig strand C' 257..259 CDD:409562 1/6 (17%)
Ig strand D 267..270 CDD:409562 0/2 (0%)
Ig strand E 275..281 CDD:409562 3/5 (60%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 0/7 (0%)
IG_like 325..410 CDD:214653 23/85 (27%)
Ig strand B 331..335 CDD:143207 0/3 (0%)
Ig strand C 344..348 CDD:143207 0/3 (0%)
Ig strand E 376..380 CDD:143207 1/3 (33%)
Ig strand F 390..395 CDD:143207 2/4 (50%)
Ig strand G 403..406 CDD:143207 0/2 (0%)
hmcn2XP_031747766.1 vWFA 29..165 CDD:238119
IG_like 434..503 CDD:214653 6/14 (43%)
Ig strand B 434..438 CDD:409353
Ig strand C 447..451 CDD:409353
Ig strand E 469..473 CDD:409353
Ig strand F 483..488 CDD:409353
Ig 514..592 CDD:472250 22/99 (22%)
Ig strand B 524..528 CDD:409353 1/3 (33%)
Ig strand C 537..541 CDD:409353 0/3 (0%)
Ig strand E 558..562 CDD:409353 1/10 (10%)
Ig strand F 572..577 CDD:409353 2/9 (22%)
Ig strand G 585..588 CDD:409353 0/2 (0%)
I-set 596..681 CDD:400151 28/94 (30%)
Ig strand B 613..617 CDD:409353 1/3 (33%)
Ig strand C 626..630 CDD:409353 0/3 (0%)
Ig strand E 648..652 CDD:409353 2/3 (67%)
Ig strand F 662..667 CDD:409353 2/4 (50%)
Ig strand G 676..679 CDD:409353 0/2 (0%)
Ig 695..770 CDD:472250 24/87 (28%)
Ig strand B 703..707 CDD:409353 0/3 (0%)
Ig strand C 716..720 CDD:409353 1/16 (6%)
Ig strand E 736..740 CDD:409353 1/3 (33%)
Ig strand F 750..755 CDD:409353 2/4 (50%)
Ig strand G 763..766 CDD:409353 0/2 (0%)
IG_like 780..864 CDD:214653 22/104 (21%)
Ig strand B 791..795 CDD:409353 0/3 (0%)
Ig strand C 804..808 CDD:409353 1/3 (33%)
Ig strand F 844..849 CDD:409353 0/4 (0%)
I-set 870..957 CDD:400151 7/20 (35%)
Ig strand B 887..891 CDD:409353 1/3 (33%)
Ig strand C 901..905 CDD:409353
Ig strand E 923..927 CDD:409353
Ig strand F 937..942 CDD:409353
Ig strand G 950..953 CDD:409353
I-set 961..1048 CDD:400151
Ig strand B 978..982 CDD:409353
Ig strand C 991..995 CDD:409353
Ig strand E 1014..1018 CDD:409353
Ig strand F 1028..1033 CDD:409353
Ig 1065..1146 CDD:472250
Ig strand B 1076..1080 CDD:409353
Ig strand C 1089..1093 CDD:409353
Ig strand E 1112..1116 CDD:409353
Ig strand F 1126..1131 CDD:409353
Ig strand G 1139..1142 CDD:409353
Ig 1157..1237 CDD:472250
Ig strand B 1167..1171 CDD:409353
Ig strand C 1180..1184 CDD:409353
Ig strand E 1203..1207 CDD:409353
Ig strand F 1217..1222 CDD:409353
Ig strand G 1230..1233 CDD:409353
Ig 1241..1329 CDD:472250
Ig strand B 1259..1263 CDD:409353
Ig strand C 1272..1276 CDD:409353
Ig strand E 1295..1299 CDD:409353
Ig strand F 1309..1314 CDD:409353
Ig strand G 1322..1325 CDD:409353
I-set 1342..1420 CDD:400151
Ig strand B 1352..1356 CDD:409353
Ig strand C 1365..1369 CDD:409353
Ig strand E 1387..1392 CDD:409353
Ig strand F 1402..1407 CDD:409353
Ig strand G 1415..1418 CDD:409353
I-set 1434..1516 CDD:400151
Ig strand B 1445..1449 CDD:409353
Ig strand C 1458..1462 CDD:409353
Ig strand E 1481..1486 CDD:409353
Ig strand F 1496..1501 CDD:409353
I-set 1538..1609 CDD:400151
Ig strand B 1539..1543 CDD:409353
Ig strand C 1552..1556 CDD:409353
Ig strand E 1574..1579 CDD:409353
Ig strand F 1589..1594 CDD:409353
Ig strand G 1602..1605 CDD:409353
Ig 1621..1703 CDD:472250
Ig strand B 1633..1637 CDD:409353
Ig strand C 1646..1650 CDD:409353
Ig strand E 1668..1673 CDD:409353
Ig strand F 1683..1688 CDD:409353
I-set 1717..1796 CDD:400151
Ig strand C 1739..1743 CDD:409353
Ig strand E 1762..1766 CDD:409353
Ig strand F 1776..1781 CDD:409353
Ig 1796..1880 CDD:472250
Ig strand B 1818..1822 CDD:409353
Ig strand C 1831..1835 CDD:409353
Ig strand F 1860..1865 CDD:409353
Ig strand G 1873..1876 CDD:409353
I-set 1886..1964 CDD:400151
Ig strand B 1901..1905 CDD:409353
Ig strand C 1914..1918 CDD:409353
Ig strand E 1936..1941 CDD:409353
Ig strand F 1951..1956 CDD:409353
Ig 1984..2063 CDD:472250
Ig strand B 1992..1996 CDD:409353
Ig strand C 2005..2009 CDD:409353
Ig strand E 2029..2033 CDD:409353
Ig strand F 2043..2048 CDD:409353
Ig strand G 2056..2059 CDD:409353
Ig_3 2066..2141 CDD:464046
Ig 2170..2246 CDD:472250
Ig strand B 2176..2180 CDD:409353
Ig strand C 2189..2193 CDD:409353
Ig strand E 2204..2216 CDD:409353
Ig strand F 2226..2231 CDD:409353
Ig strand G 2239..2242 CDD:409353
I-set 2259..2340 CDD:400151
Ig strand B 2270..2274 CDD:409353
Ig strand C 2283..2287 CDD:409353
Ig strand E 2306..2310 CDD:409353
Ig strand F 2320..2325 CDD:409353
Ig 2364..2424 CDD:409353
Ig strand B 2364..2368 CDD:409353
Ig strand C 2377..2381 CDD:409353
Ig strand E 2400..2404 CDD:409353
Ig strand F 2414..2419 CDD:409353
I-set 2447..2526 CDD:400151
Ig strand B 2456..2460 CDD:409353
Ig strand C 2469..2473 CDD:409353
Ig strand E 2492..2496 CDD:409353
Ig strand F 2506..2511 CDD:409353
Ig strand G 2519..2522 CDD:409353
I-set 2530..2622 CDD:400151
Ig strand B 2552..2556 CDD:409353
Ig strand C 2565..2569 CDD:409353
Ig strand E 2588..2592 CDD:409353
Ig strand F 2602..2607 CDD:409353
I-set 2633..2720 CDD:400151
Ig strand B 2650..2654 CDD:409353
Ig strand C 2663..2667 CDD:409353
Ig strand E 2686..2690 CDD:409353
Ig strand F 2700..2705 CDD:409353
Ig 2760..2830 CDD:472250
Ig strand B 2760..2764 CDD:409353
Ig strand C 2773..2777 CDD:409353
Ig strand E 2797..2800 CDD:409353
Ig strand F 2810..2815 CDD:409353
I-set 2839..2925 CDD:400151
Ig strand B 2855..2859 CDD:143224
Ig strand C 2868..2872 CDD:143224
Ig strand E 2891..2895 CDD:143224
Ig strand F 2905..2910 CDD:143224
Ig strand G 2918..2921 CDD:143224
I-set 2929..3017 CDD:400151
Ig strand B 2947..2951 CDD:409353
Ig strand C 2960..2964 CDD:409353
Ig strand E 2983..2987 CDD:409353
Ig strand F 2997..3002 CDD:409353
Ig strand G 3010..3013 CDD:409353
I-set 3034..3111 CDD:400151
Ig strand B 3041..3045 CDD:143207
Ig strand C 3054..3058 CDD:143207
Ig strand E 3077..3081 CDD:143207
Ig strand F 3091..3096 CDD:143207
Ig_3 3116..3189 CDD:464046
Ig_3 3206..3284 CDD:464046
I-set 3318..3391 CDD:400151
Ig strand B 3321..3325 CDD:409353
Ig strand C 3334..3338 CDD:409353
Ig strand E 3357..3361 CDD:409353
Ig strand F 3371..3376 CDD:409353
I-set 3406..3484 CDD:400151
Ig strand B 3414..3418 CDD:409353
Ig strand C 3427..3431 CDD:409353
Ig strand E 3450..3454 CDD:409353
Ig strand F 3464..3469 CDD:409353
Ig strand G 3477..3480 CDD:409353
Ig 3488..3568 CDD:472250
Ig strand B 3507..3511 CDD:409353
Ig strand C 3520..3524 CDD:409353
Ig strand E 3541..3545 CDD:409353
Ig strand F 3555..3560 CDD:409353
I-set 3585..3668 CDD:400151
Ig strand B 3598..3602 CDD:409353
Ig strand C 3611..3615 CDD:409353
Ig strand E 3633..3638 CDD:409353
Ig strand F 3648..3653 CDD:409353
Ig strand G 3661..3664 CDD:409353
I-set 3672..3759 CDD:400151
Ig strand B 3689..3693 CDD:409353
Ig strand C 3702..3706 CDD:409353
Ig strand E 3725..3729 CDD:409353
Ig strand F 3739..3744 CDD:409353
TSP1 3766..3817 CDD:214559
TSP1 3822..3873 CDD:214559
nidG2 3876..4088 CDD:469646
EGF_CA 4111..4149 CDD:214542
EGF_CA 4151..4184 CDD:429571
EGF_CA 4196..4233 CDD:214542
EGF_CA 4234..4267 CDD:214542
EGF_CA 4276..4307 CDD:429571
EGF_CA 4319..4348 CDD:429571
EGF_CA 4424..4463 CDD:214542
EGF_CA 4464..4504 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.