DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and LOC100151468

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_001921758.3 Gene:LOC100151468 / 100151468 -ID:- Length:234 Species:Danio rerio


Alignment Length:240 Identity:56/240 - (23%)
Similarity:93/240 - (38%) Gaps:51/240 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 VTVPAGRNVKLGCSVKNLGSYKVAW-MHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHI 185
            :|:..|.:|.:.|....    :..| |.|..|.|..:.::..|....:||. |:.|: ..:.:.:
Zfish    32 LTINPGGSVTIPCHYNE----ETQWQMKFWFSEIFQLRSYTNTTEENLSVI-DRPDQ-SLYTVTM 90

  Fly   186 NNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPI 250
            .|:.....|.|.|.:.:...:.....|.::|....|.|:.||.|...|..|:|::|..|...|..
Zfish    91 RNIESRQSGFYYCVLESEGKENTTYELFLMVK
SVPDVSVLSSSVSGHESGNVSIQCFYSSKYRDT 155

  Fly   251 IK-WKR-DDNSRIAINKNHI-------VNEWEGD---TLEITRISRLDMGAYLCIASNGVPPTVS 303
            .| |.| .|......||.:|       ::: :|:   |:.:|.:...|.|.|.|.|.|.:     
Zfish   156 QKQWCRYKDQKCFRENKTNISQSSSVQISD-DGENSFTVLMTGLRLSDSGWYFCSAGNRI----- 214

  Fly   304 KRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWT 348
                          :|.||.            .|||.|..:|:.|
Zfish   215 --------------VPVQLT------------V
TEAEPEHVNFST 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 19/94 (20%)
Ig 130..200 CDD:143165 16/70 (23%)
I-set 226..310 CDD:254352 25/95 (26%)
IGc2 233..298 CDD:197706 22/76 (29%)
Ig 313..410 CDD:299845 9/36 (25%)
IG_like 325..410 CDD:214653 6/24 (25%)
LOC100151468XP_001921758.3 Ig 31..122 CDD:299845 19/95 (20%)
IG_like 31..111 CDD:214653 18/84 (21%)
Ig 136..213 CDD:299845 21/77 (27%)
IG_like 138..221 CDD:214653 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.