DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and si:ch211-9d9.7

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_021322083.1 Gene:si:ch211-9d9.7 / 100150985 ZFINID:ZDB-GENE-060503-422 Length:288 Species:Danio rerio


Alignment Length:207 Identity:47/207 - (22%)
Similarity:81/207 - (39%) Gaps:64/207 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 NHVITRNPRISVT----HDKHD--RHRTWYLHI------NNVHEED------------------- 192
            ||.||..|..|||    :|:.:  :.:.||..|      .|..||:                   
Zfish    74 NHTITVKPGGSVTIPCYYDEKNPPQKKYWYSVIGESRKYTNTTEENLSVIDHPDQSLFTVTMRNL 138

  Fly   193 -----RGRYMCQINT-----VTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRC-RASGS 246
                 .|:|.|.:.|     ||.:.   :|.|...|::  |:.:|.|...||.::|::| .:||.
Zfish   139 QENKHNGKYYCTVETGQKSNVTYEL---FLQVHSAPDV--SVMNSSVSGHEGDDVSVQCFYSSGY 198

  Fly   247 PRPIIKW-----------KRDDNSRIAINKNHIVNEWEGD-TLEITRISRLDMGAYLCIASNGVP 299
            .....:|           |:.|.|:  .:...|.::.|.. |:.:|.:...|.|.:.|...:   
Zfish   199 KDKQKRWCRYKDQKCFSQKKTDTSQ--SSSVQISDDGESSFTVLMTGLRLSDSGWFFCSVGH--- 258

  Fly   300 PTVSKRIKVSVD 311
            .|:..::.|:.|
Zfish   259 QTIPVKLTVTED 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 23/97 (24%)
Ig 130..200 CDD:143165 18/76 (24%)
I-set 226..310 CDD:254352 21/96 (22%)
IGc2 233..298 CDD:197706 17/77 (22%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
si:ch211-9d9.7XP_021322083.1 Ig 76..168 CDD:325142 20/94 (21%)
Ig 180..266 CDD:325142 19/90 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.