DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and lsamp

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_031751462.1 Gene:lsamp / 100124984 XenbaseID:XB-GENE-5759171 Length:368 Species:Xenopus tropicalis


Alignment Length:369 Identity:109/369 - (29%)
Similarity:162/369 - (43%) Gaps:58/369 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRN 165
            :||   .:.|...:|....:|:||..|....|.|.|::..| :|||::  :|.|:...:...:.:
 Frog    23 LPT---GLPVRSGDFNRSTDNITVRQGDTAILRCFVEDRSS-RVAWLN--RSGIIFAGDDKWSLD 81

  Fly   166 PRISVTHDKHDRHRTWY-LHINNVHEEDRGRYMCQINTVT-AKTQFGYLNVVVPPNIDDSLSSSD 228
            ||:.:    ..|....| |.|..|...|.|.|.|.:.|.. .||...||.|.|||.|  |..|:|
 Frog    82 PRVEL----EKRSLLEYSLRIQKVDVSDEGPYTCSVQTKQHTKTTQVYLIVQVPPKI--SNISAD 140

  Fly   229 VIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHI--------VNEWEGDT--LEITRIS 283
            :.|.||:|::|.|.|.|.|.|:|.|:            |:        ..::||:.  |||..|:
 Frog   141 ITVNEGSNVTLMCIAYGRPEPMITWR------------HLTPTAGTSPARDFEGEEEFLEIQGIT 193

  Fly   284 RLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWT 348
            |...|.|.|.|:|.|.....|:::|:|::|| ::...:...|..|....:.|...|.|.....|.
 Frog   194 REQSGRYECKAANEVASADVKQVRVTVNYPP-IITESKSNEATTGKQAILRCEASAVPAPDFEWY 257

  Fly   349 RGEGPIIHDSHKYKVEATVGLPAYKTHMK--LTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVS 411
            :      .|:...::.:..||....|..:  |.:.||:....|.|.|||.|..|.|:..:.||..
 Frog   258 K------DDTRSRRINSAQGLEIRNTGSRSVLMVANVTEEHYGNYTCVAANKLGITNTSLYLYKR 316

  Fly   412 YPPTTASSGIYSTDTHWGENGINNNYAY----GGP-DSTRSIYA 450
            ..||...|.        .|.|.|.:|.|    |.| ||..|:.|
 Frog   317 VSPTKPMSA--------SERGSNVHYQYKVGPGTPIDSATSLAA 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/97 (31%)
Ig 130..200 CDD:143165 20/70 (29%)
I-set 226..310 CDD:254352 30/93 (32%)
IGc2 233..298 CDD:197706 24/74 (32%)
Ig 313..410 CDD:299845 24/98 (24%)
IG_like 325..410 CDD:214653 22/86 (26%)
lsampXP_031751462.1 Ig 38..128 CDD:416386 29/96 (30%)
FR1 38..54 CDD:409353 5/15 (33%)
Ig strand A' 39..45 CDD:409353 3/5 (60%)
Ig strand B 47..55 CDD:409353 2/7 (29%)
CDR1 55..59 CDD:409353 1/3 (33%)
FR2 60..67 CDD:409353 4/9 (44%)
Ig strand C 60..66 CDD:409353 4/6 (67%)
CDR2 68..78 CDD:409353 2/9 (22%)
Ig strand C' 70..73 CDD:409353 1/2 (50%)
Ig strand C' 75..78 CDD:409353 0/2 (0%)
FR3 79..114 CDD:409353 11/38 (29%)
Ig strand D 83..90 CDD:409353 1/10 (10%)
Ig strand E 93..99 CDD:409353 2/5 (40%)
Ig strand F 106..114 CDD:409353 3/7 (43%)
CDR3 115..119 CDD:409353 1/3 (33%)
Ig strand G 119..128 CDD:409353 4/8 (50%)
FR4 121..128 CDD:409353 3/6 (50%)
Ig_3 131..206 CDD:404760 30/88 (34%)
Ig strand A' 138..143 CDD:409353 2/4 (50%)
Ig strand B 149..156 CDD:409353 2/6 (33%)
Ig strand C 162..167 CDD:409353 2/16 (13%)
Ig strand C' 173..175 CDD:409353 0/1 (0%)
Ig strand E 185..191 CDD:409353 3/5 (60%)
Ig strand F 198..205 CDD:409353 3/6 (50%)
Ig strand G 212..220 CDD:409353 2/7 (29%)
Ig_3 223..302 CDD:404760 20/85 (24%)
putative Ig strand A 224..230 CDD:409353 1/6 (17%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 1/3 (33%)
Ig strand F 295..300 CDD:409353 2/4 (50%)
Ig strand G 308..311 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.