DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and pigrl2.3

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001077347.1 Gene:pigrl2.3 / 100003983 ZFINID:ZDB-GENE-150409-2 Length:244 Species:Danio rerio


Alignment Length:215 Identity:51/215 - (23%)
Similarity:81/215 - (37%) Gaps:43/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 VTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHIN 186
            :||..|.:|.:.|......:....|.......    :.:..|....:||.  .|.......:.:.
Zfish    33 LTVKPGGSVTIPCYYDEKNTQLKYWYSVNDEC----NTYTNTTEENLSVI--DHPDQSLVTVTMR 91

  Fly   187 NVHEEDRGRYMCQI--NTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRP 249
            |:.|:..|.|.|.:  ..|..|.   ||.|...|::  |:.||.|...||.|:|::|..|...|.
Zfish    92 NLQEKHTGEYHCGVVPGGVIYKI---YLQVQDVPDV--SVKSSSVSGHEGGNVSVQCFYSSGYRD 151

  Fly   250 IIK-WKR--------------DDNSRIAINKNHIVNEWEGD---TLEITRISRLDMGAYLCIASN 296
            ..| |.|              ..||.:.|:.       :|:   |:.:|.::..|.|.|.|.|..
Zfish   152 KQKRWCRFKDEKCFREKKTNTSKNSSVQISD-------DGESSFTVLMTGLTLSDSGWYYCSAGE 209

  Fly   297 GVPP-----TVSKRIKVSVD 311
            .:.|     |.|:.:.|:.|
Zfish   210 QILPLQLTVTTSESVSVNTD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 20/95 (21%)
Ig strand B 130..134 CDD:409405 1/3 (33%)
Ig strand C 143..147 CDD:409405 0/3 (0%)
Ig strand E 178..185 CDD:409405 0/6 (0%)
IgI_1_MuSK 218..310 CDD:409562 30/114 (26%)
Ig strand A 218..221 CDD:409562 1/2 (50%)
Ig strand A' 226..231 CDD:409562 3/4 (75%)
Ig strand B 237..244 CDD:409562 2/6 (33%)
Ig strand C 250..255 CDD:409562 2/5 (40%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 0/2 (0%)
Ig strand E 275..281 CDD:409562 1/8 (13%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 2/7 (29%)
IG_like 325..410 CDD:214653
Ig strand B 331..335 CDD:143207
Ig strand C 344..348 CDD:143207
Ig strand E 376..380 CDD:143207
Ig strand F 390..395 CDD:143207
Ig strand G 403..406 CDD:143207
pigrl2.3NP_001077347.1 Ig 33..105 CDD:472250 15/77 (19%)
Ig strand B 41..45 CDD:409353 1/3 (33%)
Ig strand C 54..58 CDD:409353 0/3 (0%)
Ig strand E 86..90 CDD:409353 0/3 (0%)
Ig strand F 100..105 CDD:409353 2/4 (50%)
Ig 133..209 CDD:472250 21/82 (26%)
Ig strand B 139..143 CDD:409353 1/3 (33%)
Ig strand C 153..157 CDD:409353 1/3 (33%)
Ig strand E 188..192 CDD:409353 1/3 (33%)
Ig strand F 202..207 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.