DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and si:dkeyp-104b3.1

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_073787238.1 Gene:si:dkeyp-104b3.1 / 100001870 ZFINID:ZDB-GENE-070912-623 Length:264 Species:Danio rerio


Alignment Length:228 Identity:53/228 - (23%)
Similarity:88/228 - (38%) Gaps:42/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 YIENVTVPAGRNVKLGC--SVKNLGSYKVAWMH---FEQSAILTVHNHVITRNPRISVTHDKHDR 177
            |..|:.|.:|....:.|  .||:..:.|. |..   :...::|...|.  ||| :.|:|  .:..
Zfish    31 YNLNIRVKSGSPGIIPCQYEVKHKANRKY-WCQGSVWSSCSVLAYANE--TRN-QFSIT--DYPA 89

  Fly   178 HRTWYLHINNVHEEDRGRYMCQIN-TVTAKTQFG-YLNVVVPPNIDDSLSSSDVIVREGANISLR 240
            ...:.:...|:...|.|.|.|.:. :.|.....| |:.:.|..:.|.|:.||.|...||.::.::
Zfish    90 QSVFTVEWQNLQPSDSGCYWCAVEISGTGILDAGYYVYLTVQSDPDASVMSSSVSAHEGDDVRVQ 154

  Fly   241 C-RASGSPRPIIKWKRDDNSRIAINKN---------HIVNEWEGD-TLEITRISRLDMGAYLCIA 294
            | ..||.......|.|..:.|....|.         .|.::.|.. |:.:|.::..|.|.|.|..
Zfish   155 CFYTSGYQNDFKHWCRYKDQRCFTKKKTDTSQNSSVQISDDGESSFTVLMTGLTLSDSGWYFCSV 219

  Fly   295 SNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPE 327
            .:         ::|.|         |.:|..||
Zfish   220 GD---------LQVHV---------HLIVTKPE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 23/102 (23%)
Ig strand B 130..134 CDD:409405 0/3 (0%)
Ig strand C 143..147 CDD:409405 1/3 (33%)
Ig strand E 178..185 CDD:409405 0/6 (0%)
IgI_1_MuSK 218..310 CDD:409562 23/102 (23%)
Ig strand A 218..221 CDD:409562 0/2 (0%)
Ig strand A' 226..231 CDD:409562 3/4 (75%)
Ig strand B 237..244 CDD:409562 1/7 (14%)
Ig strand C 250..255 CDD:409562 1/4 (25%)
Ig strand C' 257..259 CDD:409562 0/1 (0%)
Ig strand D 267..270 CDD:409562 1/2 (50%)
Ig strand E 275..281 CDD:409562 1/6 (17%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 1/7 (14%)
IG_like 325..410 CDD:214653 2/3 (67%)
Ig strand B 331..335 CDD:143207
Ig strand C 344..348 CDD:143207
Ig strand E 376..380 CDD:143207
Ig strand F 390..395 CDD:143207
Ig strand G 403..406 CDD:143207
si:dkeyp-104b3.1XP_073787238.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.