DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and ODC1

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_015191.1 Gene:ODC1 / 855969 SGDID:S000006055 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:299 Identity:97/299 - (32%)
Similarity:166/299 - (55%) Gaps:26/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WQFLAGGLSGFIEIICFHPLDVVKTRMQIQ---GAHPFGGEVV--------YTCPLDAIVKIYRY 68
            :||.||.::|..|::..:||||||||||:|   ..||   .||        ||..:|.:.||.:.
Yeast    13 YQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHP---AVVAAKAAVDHYTGVMDCLTKIVKK 74

  Fly    69 EGLSSLWKGIVPPICVETPKRGGKFLMYESLKPYFQFGAPQP----TPLTHAMSGSMAAILESFL 129
            ||.|.|:|||..||.:|.|||..||...::.:.:::...|.|    |......||:.|..:|:|:
Yeast    75 EGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASAGAVEAFV 139

  Fly   130 VNPFEVVKITQQAHRGKRLKTLSVVK-YIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNAL 193
            |.|||:|||..|....:....:.||| .::|.   |:..|:.|:.|.:.|:.:::.|:||....:
Yeast   140 VAPFELVKIRLQDVNSQFKTPIEVVKNSVVKG---GVLSLFNGLEATIWRHVLWNAGYFGIIFQI 201

  Fly   194 KDIVPSPEDKTYNILRKVIIAGLASSLACVMSVTLDMAKCRIQ-GPQPVKGEVKYQWTISTIKST 257
            :.::|:.:..|......:|...:..::.|:::...|:.|.||| ...|::   ||.|::.::...
Yeast   202 RKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLR---KYNWSLPSVLLV 263

  Fly   258 FKEEGFRSLFKGLGAMILRVGPGGAMLLVTYEYLFEFLK 296
            ::||||::|:||....::|:.|||.:|||.:..:.:|.:
Yeast   264 YREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDFFR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 96/295 (33%)
Mito_carr 17..104 CDD:278578 40/97 (41%)
Mito_carr 109..196 CDD:278578 27/91 (30%)
Mito_carr 216..295 CDD:278578 24/79 (30%)
ODC1NP_015191.1 Mito_carr 8..113 CDD:395101 41/102 (40%)
PTZ00169 11..302 CDD:240302 97/297 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346472
Domainoid 1 1.000 87 1.000 Domainoid score I1835
eggNOG 1 0.900 - - E1_KOG0754
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I810
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53612
OrthoFinder 1 1.000 - - FOG0004440
OrthoInspector 1 1.000 - - mtm9243
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2643
TreeFam 1 0.960 - -
1110.760

Return to query results.
Submit another query.