DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and SAMC2

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_564436.4 Gene:SAMC2 / 840304 AraportID:AT1G34065 Length:345 Species:Arabidopsis thaliana


Alignment Length:301 Identity:74/301 - (24%)
Similarity:127/301 - (42%) Gaps:58/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVPPI 82
            :.|||:|.:.....:|:|.:|||:|:...   ||:::                    |||:...:
plant    83 ITGGLAGVVVEAALYPIDTIKTRIQVARD---GGKII--------------------WKGLYSGL 124

  Fly    83 CVETPKRGGKFLMYESLKPYFQFGAPQPT-------------PLTHAMSGSMAAILESFLVNPFE 134
                   ||..:........| ||..:||             .:.|..:|::...:.|.:..|.|
plant   125 -------GGNLVGVLPASALF-FGVYEPTKQKLLKVLPDNLSAVAHLAAGALGGAVSSIVRVPTE 181

  Fly   135 VVKITQQAHRGKRLKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVPS 199
            |||  |:...|:.:.....|:.||..:|:|  |:|.|..:.:.|:..|....|..|..|:.....
plant   182 VVK--QRMQTGQFVSAPDAVRLIIAKEGFG--GMYAGYGSFLLRDLPFDALQFCVYEQLRIGYKL 242

  Fly   200 PEDKTYNILRKVIIAGLASSLACVMSVTLDMAKCRIQGPQPVKGE-VKYQWTISTIKSTFKEEGF 263
            ...:..|.....:|...|.::..|::..||:.|.|:.    |:|. .:|:.....||:..:|||.
plant   243 AARRDLNDPENAMIGAFAGAVTGVLTTPLDVIKTRLM----VQGSGTQYKGVSDCIKTIIREEGS 303

  Fly   264 RSLFKGLGAMILRVGPGGAMLLVTYEYLFEFL-----KSQN 299
            .:|:||:|..:|.:|.||::.....|...:.|     ||.|
plant   304 SALWKGMGPRVLWIGIGGSIFFGVLEKTKQILSERSQKSHN 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 71/296 (24%)
Mito_carr 17..104 CDD:278578 17/85 (20%)
Mito_carr 109..196 CDD:278578 25/99 (25%)
Mito_carr 216..295 CDD:278578 23/79 (29%)
SAMC2NP_564436.4 Mito_carr 78..153 CDD:278578 22/100 (22%)
PTZ00168 79..328 CDD:185494 69/283 (24%)
Mito_carr 155..237 CDD:278578 22/85 (26%)
Mito_carr 247..339 CDD:278578 26/95 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.