DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and slc25a21

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001070100.1 Gene:slc25a21 / 767694 ZFINID:ZDB-GENE-060929-664 Length:298 Species:Danio rerio


Alignment Length:299 Identity:116/299 - (38%)
Similarity:185/299 - (61%) Gaps:7/299 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATRSEETVRSLAHWQFLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKI 65
            |.::.:..:|..:| |.:|||.:|.:||...|||||||||.|||........  |....|....|
Zfish     1 MTSKKKSLLREASH-QIIAGGSAGLVEICLMHPLDVVKTRFQIQRGKSDPNS--YKGLGDCFRTI 62

  Fly    66 YRYEGLSSLWKGIVPPICVETPKRGGKFLMYESLKPYFQFGAPQPTPLTHAMSGSMAAILESFLV 130
            :|.||:...:|||:|||..|||||..||..:|..|....|.:..| .:..:::|..:.:.|:.:|
Zfish    63 FRTEGVYGFYKGILPPILAETPKRAVKFFTFEQYKKLLSFTSLSP-GMALSVAGLGSGLTEALVV 126

  Fly   131 NPFEVVKITQQAHRGK---RLKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNA 192
            |||||||::.||:|..   :..|.:..:.||..||:|::||.:|:|:.:.|:.||:..:||||..
Zfish   127 NPFEVVKVSLQANRDSFKVQPSTFAQARNIINTDGFGLRGLNKGLTSTLGRHGVFNMIYFGFYFN 191

  Fly   193 LKDIVPSPEDKTYNILRKVIIAGLASSLACVMSVTLDMAKCRIQGPQPVKGEVKYQWTISTIKST 257
            :||.:|:.:|.....:||..|..::.:::..:::..|:||.||||||||.||:||:....::...
Zfish   192 VKDAIPASQDPRLEFMRKFAIGLVSGTVSSCVNIPFDVAKSRIQGPQPVPGEIKYRSCFQSMALV 256

  Fly   258 FKEEGFRSLFKGLGAMILRVGPGGAMLLVTYEYLFEFLK 296
            ::|||:.:|:|||...|:|:|||||::|:.|||:..:|:
Zfish   257 YREEGYLALYKGLIPKIMRLGPGGAVMLLVYEYMSGWLQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 111/281 (40%)
Mito_carr 17..104 CDD:278578 39/86 (45%)
Mito_carr 109..196 CDD:278578 32/89 (36%)
Mito_carr 216..295 CDD:278578 33/78 (42%)
slc25a21NP_001070100.1 Mito_carr 14..100 CDD:278578 41/88 (47%)
PTZ00169 17..288 CDD:240302 108/273 (40%)
Mito_carr 113..194 CDD:278578 30/80 (38%)
Mito_carr 203..297 CDD:278578 37/93 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595857
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0754
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53612
OrthoDB 1 1.010 - - D1236425at2759
OrthoFinder 1 1.000 - - FOG0004440
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2643
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.