DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and mfrn

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:284 Identity:71/284 - (25%)
Similarity:122/284 - (42%) Gaps:31/284 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVPPIC 83
            ||.::|.:|.:..:|||.||||||..........:|.|     :..:...|||....:|....:.
  Fly    20 AGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVST-----LRTMITREGLLRPIRGASAVVL 79

  Fly    84 VETPKRGGKFLMYESLKPY-FQFGAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQQAHRGKR 147
            ...|.....|..||..|.. .:|.:.:  .|.:.:||::|.::...:.:|.:|:|...|.:....
  Fly    80 GAGPAHSLYFAAYEMTKELTAKFTSVR--NLNYVISGAVATLIHDAISSPTDVIKQRMQMYNSPY 142

  Fly   148 LKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVF---HFGFFGFYNALKDIVPSPEDKTYNILR 209
            ...:|.|:.|.|.:|:  |..||.....:..|..:   ||..:.|:....::     ::.||  .
  Fly   143 TSVVSCVRDIYKREGF--KAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNL-----ERKYN--P 198

  Fly   210 KVIIAGLASSLACVMSVT--LDMAKCRIQGPQP--VKGEVKYQWTISTIKSTFKEEGFRSLFKGL 270
            .|.:|..|::.||..:||  ||:.|..:...:.  .:|      .|...:..:...|....|:|.
  Fly   199 PVHMAAGAAAGACAAAVTTPLDVIKTLLNTQETGLTRG------MIEASRKIYHMAGPLGFFRGT 257

  Fly   271 GAMILRVGPGGAMLLVTYEYLFEF 294
            .|.:|...|..|:...|||: |:|
  Fly   258 TARVLYSMPATAICWSTYEF-FKF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 71/284 (25%)
Mito_carr 17..104 CDD:278578 24/85 (28%)
Mito_carr 109..196 CDD:278578 20/89 (22%)
Mito_carr 216..295 CDD:278578 22/83 (27%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 24/82 (29%)
PTZ00168 17..280 CDD:185494 70/282 (25%)
Mito_carr 107..190 CDD:278578 20/84 (24%)
Mito_carr <215..282 CDD:278578 19/73 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.