DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and Dic1

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:292 Identity:74/292 - (25%)
Similarity:119/292 - (40%) Gaps:47/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WQFLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIV 79
            |.|  |||:.....:..||||::|..:|.|..|....::        |.|:.|.:|:...:.|:.
  Fly    10 WFF--GGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQL--------IPKLAREQGVLVFYNGLS 64

  Fly    80 PPICVETPKRGGKFLMYESLKPYFQFGAPQPTPLTHAMSGSMAAILESFLV-----NPFEVVKIT 139
            ..:..:......:|.:||:.|.|..         |.:..|.:|....|.||     .|.::|.:.
  Fly    65 ASVLRQLTYSTARFGVYEAGKKYVN---------TDSFGGKVALAGASGLVGGIVGTPADMVNVR 120

  Fly   140 QQAHRGKRLKTLSVVKYIIKHDGY-------GIKGLYRGITALVARNAVFHFGFFGFYNALKDIV 197
            .|  ...:|.......|....||.       |.|.|:.|.||..||..:...|...||:..|..:
  Fly   121 MQ--NDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYL 183

  Fly   198 ---PSPEDKTYNILRKVIIAGLASSLACVMSVTLDMAKCRIQGPQPVKGEVKYQWTISTIKSTFK 259
               |..:|   |::.....:.:|.::|..::..||:.|.|....:|  ||....|.|  :|.|.|
  Fly   184 LATPYFQD---NLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKP--GEFNGLWDI--VKHTAK 241

  Fly   260 EEGFRSLFKGLGAMILRVGPGGAMLLVTYEYL 291
             .|....|||.....:|:||   ..::|:.:|
  Fly   242 -LGPLGFFKGYVPAFVRLGP---HTIITFVFL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 73/290 (25%)
Mito_carr 17..104 CDD:278578 22/86 (26%)
Mito_carr 109..196 CDD:278578 25/98 (26%)
Mito_carr 216..295 CDD:278578 23/76 (30%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 24/100 (24%)
PTZ00169 13..273 CDD:240302 72/287 (25%)
Mito_carr 89..184 CDD:278578 25/105 (24%)
Mito_carr 189..278 CDD:278578 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441948
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.