DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and GC2

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:298 Identity:87/298 - (29%)
Similarity:140/298 - (46%) Gaps:34/298 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVP 80
            :.:.||::|.|.:.|.:|||:||||:|.|...| .||.:||...|...|....||...:::|...
  Fly    23 KIINGGVAGIIGVACVYPLDMVKTRLQNQTIGP-NGERMYTSIADCFRKTIASEGYFGMYRGSAV 86

  Fly    81 PICVETPKRGGKFLMYESLKPYFQFGAPQP---TPLTHA-MSGSMAAILESFLVNPFEVVKITQQ 141
            .|.:.||::..|.    :...:|::.....   .||:.| ::|.:|.:.:..:..|.|::||..|
  Fly    87 NIVLITPEKAIKL----TANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQMQ 147

  Fly   142 -------AHR--GKRLKT---LSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALK 194
                   |.|  |:.:||   |.:.|.:::.  .||.|||:|:.|...|:..|...:|.....:.
  Fly   148 DAGRVAAADRAAGREVKTITALGLTKTLLRE--RGIFGLYKGVGATGVRDITFSMVYFPLMAWIN 210

  Fly   195 DIVPSPEDKTYN-ILRKVIIAGLASSLACVMSVT-LDMAKCRIQGPQPVKGEVKYQWTISTIKST 257
            |..|...|.:.. :....:||||.|.:.....|| .|:.|.|:|    ..||.|::..:..:..|
  Fly   211 DQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQ----ADGEKKFKGIMDCVNRT 271

  Fly   258 FKEEGFRSLFKGLGAMILRVGPGGAMLLVTYEYLFEFL 295
            .||||..:.|||....|:.:.|     |.....:|.||
  Fly   272 LKEEGISAFFKGGLCRIMVLAP-----LFGIAQMFYFL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 87/297 (29%)
Mito_carr 17..104 CDD:278578 28/86 (33%)
Mito_carr 109..196 CDD:278578 27/102 (26%)
Mito_carr 216..295 CDD:278578 23/79 (29%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 81/276 (29%)
Mito_carr 16..106 CDD:278578 28/87 (32%)
Mito_carr 123..203 CDD:278578 23/81 (28%)
Mito_carr 228..302 CDD:278578 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.