DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and CG2616

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:344 Identity:90/344 - (26%)
Similarity:147/344 - (42%) Gaps:68/344 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFLAGGLSGFIEIICF-HPLDVVKTRMQIQ--GAH-----------------PFGGEVV------ 54
            |.:....:|.:...|| .||||:|||||.|  .||                 |.|.|:.      
  Fly    92 QQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRP 156

  Fly    55 -YTCPLDAIVKIYRYEGLSSLWKGIVPPICVETPKRGGKFLMYESLKP-YFQF------------ 105
             ::...||::||.|:|||::||.|:.|.:....|.....|:.||..|. |.|.            
  Fly   157 QFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPR 221

  Fly   106 ---------GAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQQAHRGKRLKTLSVVKYIIKHD 161
                     ..|...|:   |||..|.|....:|:|.|:|:...||.|....:.|..|:.::...
  Fly   222 HLEIRDTKKSLPSVVPM---MSGVTARICAVTVVSPIELVRTKMQAQRQTYAQMLQFVRSVVALQ 283

  Fly   162 GYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVPSPEDKTYNILRKVIIAG-LASSLACVMS 225
              |:.||:||:...:.|:..|...::..|.:||..:......::::   ..:|| :|.::|.:::
  Fly   284 --GVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGHGSQPSFSL---SFLAGVMAGTVAAIVT 343

  Fly   226 VTLDMAKCRIQ---------GPQPVKGEVKYQWTISTIKSTFKEEGFRSLFKGLGAMILRVGPGG 281
            ...|:.|...|         ...|.:...| :.|.|.:...::..|.|.||.|.|..:|:|.|..
  Fly   344 TPFDVVKTHEQIEFGERVIFTDSPARDFGK-KSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPAC 407

  Fly   282 AMLLVTYEYLFEFLKSQNI 300
            |:::.|:||...|....|:
  Fly   408 AIMISTFEYSKSFFFHYNV 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 88/337 (26%)
Mito_carr 17..104 CDD:278578 36/114 (32%)
Mito_carr 109..196 CDD:278578 25/86 (29%)
Mito_carr 216..295 CDD:278578 22/87 (25%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 36/114 (32%)
Mito_carr 230..321 CDD:278578 26/95 (27%)
Mito_carr 321..425 CDD:278578 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.