DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and Mpcp2

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:299 Identity:73/299 - (24%)
Similarity:111/299 - (37%) Gaps:55/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FLAGGLSGFIEIICFH----PLDVVKTRMQIQGA------HPFGGEVVYTCPLDAIVKIYRYEGL 71
            |...|:.|.:.....|    |||:||.|:|:..|      |.|...|.             .||.
  Fly    62 FALCGIGGILSCGTTHTFVVPLDLVKCRLQVDQAKYKNLVHGFKVTVA-------------EEGA 113

  Fly    72 SSLWKGIVPPICVETPKRGGKFLMYESLK-PYFQFGAPQ-----PTPLTHAMSGSMAAILESFLV 130
            ..|.||..|.:...:.:...||.:||..| .|.:....:     .|.|..|.|.| |.......:
  Fly   114 RGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASAS-AEFFADIAL 177

  Fly   131 NPFEVVKITQQAHRGKRLKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYN---- 191
            .|||..|:..|...|........|..::|.:  |:...|:|:..|..|...:....|..:.    
  Fly   178 APFEAAKVKIQTIPGYANNFREAVPKMLKEE--GVNAFYKGLVPLWMRQIPYTMMKFACFERTVE 240

  Fly   192 -ALKDIVPSPE-DKTYNILRKVII---AGLASSLAC-VMSVTLDMAKCRIQGPQPVKGEVKYQWT 250
             ..|.:||.|. |.|..  .::|:   ||..:.:.| |:|...|:...::       .:.|....
  Fly   241 LLYKYVVPKPRADCTKG--EQLIVTFAAGYIAGVFCAVVSHPADVVVSKL-------NQAKGASA 296

  Fly   251 ISTIKSTFKEEGFRSLFKGLGAMILRVGPGGAMLLVTYE 289
            ||..||.    ||..::.||...|:.:|...|:....|:
  Fly   297 ISVAKSL----GFSGMWNGLTPRIIMIGTLTALQWFIYD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 73/299 (24%)
Mito_carr 17..104 CDD:278578 27/97 (28%)
Mito_carr 109..196 CDD:278578 21/96 (22%)
Mito_carr 216..295 CDD:278578 17/75 (23%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 25/92 (27%)
Mito_carr <175..245 CDD:278578 14/71 (20%)
Mito_carr 260..338 CDD:278578 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.