DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and CG7514

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:295 Identity:84/295 - (28%)
Similarity:130/295 - (44%) Gaps:30/295 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HWQFLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGI 78
            :..::.|||:|.:......|||:|||||||...   .||  |....|.::|:::.||:.:|:.|:
  Fly    13 YMMYINGGLAGMLGTCIVQPLDLVKTRMQISAT---TGE--YKSSFDCLLKVFKNEGILALYNGL 72

  Fly    79 VPPI---CVETPKRGGKFLMYESLKPY-FQFGAPQPTPLTHAMSGSMAAILESFLVNPFEVVKIT 139
            ...:   ...|..|.|.:.|  .:..| .||.|| ||.|.....|.:|....:...||.||..|.
  Fly    73 SAGLMRQATYTTARMGFYQM--EIDAYRKQFNAP-PTVLASMGMGILAGAFGAMFGNPAEVALIR 134

  Fly   140 QQ-------AHRGKRLKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIV 197
            ..       |.|......|:....|:|.:  |:..|::|....|.|..:.:......|:.||   
  Fly   135 MMSDNRLPPAERRNYTGVLNAFVRIVKDE--GVITLWKGCMPTVGRAMIVNMVQLASYSQLK--- 194

  Fly   198 PSPEDKTYNILRKVIIAGLASS-LACVMSVTLDMAKCRIQGPQPVKGEVKYQWTISTIKSTFKEE 261
             :...:.::.|...|.|.:.|. |..:.|:.|||||.|||..:    ..:|:.|:..:....|.|
  Fly   195 -AAFSEYFSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQK----TAEYKGTMDVLMKVSKNE 254

  Fly   262 GFRSLFKGLGAMILRVGPGGAMLLVTYEYLFEFLK 296
            |..||:||....:.|:||......:..|.|.:..|
  Fly   255 GIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 83/290 (29%)
Mito_carr 17..104 CDD:278578 28/90 (31%)
Mito_carr 109..196 CDD:278578 23/93 (25%)
Mito_carr 216..295 CDD:278578 25/79 (32%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 83/288 (29%)
Mito_carr 19..90 CDD:278578 26/75 (35%)
Mito_carr 104..201 CDD:278578 24/103 (23%)
Mito_carr 207..284 CDD:278578 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.