DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and Tpc2

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:315 Identity:76/315 - (24%)
Similarity:134/315 - (42%) Gaps:49/315 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPF----GGEVVYTCPLDAIVKIYRYEGLSSLWK 76
            |.:.||::|........||||:|.|.|:| ..|.    |.:  |...:.|...:|..||:..:::
  Fly    12 QAVGGGIAGAATRTITQPLDVLKIRFQMQ-VEPVTNHKGSK--YRGVIHAFKSVYAEEGMRGMFR 73

  Fly    77 GIVPPICVETPKRGGKFLMYESLKP---YFQFGAPQPTPLTHAMSGSMAAILESFLVNPFEVVKI 138
            |......:.......:|..||.|:.   .|.:...:|. |...:.|.:|..|.:....||:||: 
  Fly    74 GHNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPF-LMFFICGGIAGCLGAVAAQPFDVVR- 136

  Fly   139 TQQ-----AHRGKRLKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVF-----HFGFFGFYNAL 193
            ||.     :.|..::.|.:.::.:.|.:|:  .||.||:...:.:  ||     :|.|:.:.||.
  Fly   137 TQMVAADPSSRRSQMNTFTGLRKVYKMEGW--MGLSRGLPFTLVQ--VFPLVGANFLFYKYLNAA 197

  Fly   194 KDIVPSPEDKTYNILRKVII--AGLASSLACVMSVTLDMAKCRIQ-----------GPQPVKGEV 245
            . ::..|.|:...|....:.  ..|:..||.::....|:.|.|||           |..|     
  Fly   198 V-LMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNP----- 256

  Fly   246 KYQWTISTIKSTFKEEGFRSLFKGLGAMILRVGPGGAMLLVTYEYLFEFLKSQNI 300
            :....:..|.:||:|||....:||:...:|:.|    ::...|..:::..|...|
  Fly   257 ECPTILGCITTTFREEGIGGFYKGMLPTLLKAG----LMSAVYFSIYDMFKRHYI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 73/308 (24%)
Mito_carr 17..104 CDD:278578 23/93 (25%)
Mito_carr 109..196 CDD:278578 25/96 (26%)
Mito_carr 216..295 CDD:278578 21/89 (24%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 70/299 (23%)
Mito_carr 23..99 CDD:278578 20/78 (26%)
Mito_carr 108..194 CDD:278578 23/91 (25%)
Mito_carr 216..307 CDD:278578 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.