DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and CG18324

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:295 Identity:72/295 - (24%)
Similarity:128/295 - (43%) Gaps:27/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVV--YTCPLDAIVKIYRYEGLSSLWKGIV 79
            |:.||.:....::..:|:||||||||:||.....|..|  |.....|:::|...:||.:|.||:.
  Fly     6 FVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLA 70

  Fly    80 PPICVETPKRGGKFLMYESLKP--YFQFGAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQQA 142
            |.:|.:......:..:|.:...  |.|......:.......|::.....::..:||.::|..|.|
  Fly    71 PALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQHA 135

  Fly   143 H---------RGKRLKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVP 198
            .         :.|....:..:.:|.:.:  ||.|.:|.....:.|..|......|.:...|.:: 
  Fly   136 QAVQSIAVGFQHKHTSMMDALLHIYRTN--GISGFWRAALPSLNRTLVASSVQIGTFPKAKSLL- 197

  Fly   199 SPEDKTYNILRKVII---AGLAS-SLACVMSVTLDMAKCRIQGPQPV--KGE-VKYQWTISTIKS 256
              :||.: |...|::   |||:| :|..|.:...|:...|:.. |||  ||. :.|:..:.....
  Fly   198 --KDKGW-ITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYN-QPVDEKGRGLMYKGLVDCFTK 258

  Fly   257 TFKEEGFRSLFKGLGAMILRVGPGGAMLLVTYEYL 291
            .::.||...::||...:..|..|...:..|.:|.|
  Fly   259 IWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 72/295 (24%)
Mito_carr 17..104 CDD:278578 28/90 (31%)
Mito_carr 109..196 CDD:278578 16/95 (17%)
Mito_carr 216..295 CDD:278578 21/80 (26%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 26/80 (33%)
PTZ00169 5..293 CDD:240302 71/293 (24%)
Mito_carr 101..201 CDD:278578 17/104 (16%)
Mito_carr 204..296 CDD:278578 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441364
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.