DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and Dic3

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:314 Identity:72/314 - (22%)
Similarity:118/314 - (37%) Gaps:72/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EETVRSLAHWQFLAGGLSGFIEIICFHPLDVVKTRMQIQ-------------GAHPFGGEVVYTC 57
            |::.|.|..|.|  ||:...|.:...||:|::|.::|.|             |.|...|.:.:  
  Fly     3 EDSSRRLPRWWF--GGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGILGF-- 63

  Fly    58 PLDAIVKIYRYEGLSSLWKGIVPPICVETPKRGGKFLMYESLKPYFQFGAPQPTPLTHAMSGSM- 121
                      |.|:|:.|   ...:...|.    :|.:||:.|.|..         |..:|..| 
  Fly    64 ----------YNGISASW---FRQLTYTTT----RFALYEAGKDYVD---------TQKVSSKMA 102

  Fly   122 ----AAILESFLVNPFEVVKITQQAHRGKRLKTLSVVKYIIKH--DGY-------GIKGLYRGIT 173
                |.|:...:..|.:||.:..|    ..:|.....:...||  ||.       |:..|:||..
  Fly   103 LATFAGIVGGIVGVPGDVVTVRLQ----NDVKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTV 163

  Fly   174 ALVARNAVFHFGFFGFYNALKDIVPSPEDKTYNILRKVIIAGLASSLACVMSVTLDMAKCRIQGP 238
            ..|:|..:...|....|:.:|.::.........:......:.:|..:|.|::..||:.|......
  Fly   164 PAVSRAVLLTIGTNAAYDQVKQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNA 228

  Fly   239 QPVKGEVKYQWTISTIKSTF---KEEGFRSLFKGLGAMILRVGPGGAMLLVTYE 289
            ||  ||      .|.|...|   .::|..:.:||....::||.|...:..|.||
  Fly   229 QP--GE------FSGIGGAFLSTAKQGPLAFYKGFIPALIRVSPNTIITFVLYE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 68/303 (22%)
Mito_carr 17..104 CDD:278578 23/99 (23%)
Mito_carr 109..196 CDD:278578 23/100 (23%)
Mito_carr 216..295 CDD:278578 22/77 (29%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 67/300 (22%)
Mito_carr 15..91 CDD:278578 21/94 (22%)
Mito_carr 93..187 CDD:278578 23/106 (22%)
Mito_carr 200..281 CDD:278578 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441956
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.