DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and MME1

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:297 Identity:77/297 - (25%)
Similarity:135/297 - (45%) Gaps:31/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVPP 81
            |:|||:.|...::..||||.:|.|:|.....|.|....|...:|...:.:||||....::||..|
  Fly    18 FIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAP 82

  Fly    82 ICVETPKRGGKFLMYESLKPYFQFGAPQPTPLTHAM---SGSMAAILESFLVNPFEVVKI---TQ 140
            :...||.....|.:|.:.|..||  ......||:..   :|::|.:..:.:..|.:.:|:   ||
  Fly    83 LVGVTPIYAVDFAVYAAGKRLFQ--TDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQ 145

  Fly   141 QAHRGKRL--KTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVPSPEDK 203
            ....|..|  .|:.....:.:..  ||:.|::|..|.:.|::...| :|..|..|:::.   ..|
  Fly   146 TVSNGPLLYNGTIDTAAKLYRQG--GIRSLFKGTCACILRDSPTGF-YFVTYEFLQELA---RKK 204

  Fly   204 TYN----ILRKVIIAGLASSLACVMSVTLDMAKCRIQGPQPVKGEVKYQWTISTIKSTFKE---- 260
            :.|    ....::..|.|..:...::|..|:.|.|:|...  :|..|:     .|:|.|:.    
  Fly   205 SANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAP--EGTYKH-----GIRSVFRNLMAT 262

  Fly   261 EGFRSLFKGLGAMILRVGPGGAMLLVTYEYLFEFLKS 297
            ||.::||:|:..::||..|..|.:....|...:.||:
  Fly   263 EGPKALFRGILPILLRAFPSTAAVFFGVELTNDLLKA 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 75/294 (26%)
Mito_carr 17..104 CDD:278578 28/86 (33%)
Mito_carr 109..196 CDD:278578 21/94 (22%)
Mito_carr 216..295 CDD:278578 21/82 (26%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 30/90 (33%)
Mito_carr 111..205 CDD:278578 21/99 (21%)
Mito_carr 208..297 CDD:278578 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441761
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.