DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and Ucp4B

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:285 Identity:82/285 - (28%)
Similarity:135/285 - (47%) Gaps:22/285 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HPLDVVKTRMQIQG--AHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVPPICVETPKRGGKFL 94
            :|.|:.||||||||  |...|.:..|...|...:.|.|.|||..|:.||...:...:...|.|.|
  Fly    55 YPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKML 119

  Fly    95 MYESLKPYF----QFGAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQQAHRGKRLK------ 149
            .|:.::...    :.|.||.:.|...:||.:|....|.|.||.|::||..|....:||:      
  Fly   120 TYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRI 184

  Fly   150 --TLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVPSPEDKTYNILRKV- 211
              .|..:..|.:..  |:.||::|......|:|:...|....|:..|..:.:..|...|  |:| 
  Fly   185 HNVLQALTSIYRTG--GVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDN--REVQ 245

  Fly   212 IIAGLASSLA-CVMSVTLDMAKCRIQG-PQPVKGE-VKYQWTISTIKSTFKEEGFRSLFKGLGAM 273
            .:|.:.:.:| .::|:..|:.|.||.. |...:|. :.|:.::..:....:||||.:::||....
  Fly   246 FVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPY 310

  Fly   274 ILRVGPGGAMLLVTYEYLFEFLKSQ 298
            .:||||...:..:|:|.:..|..|:
  Fly   311 WMRVGPASVVFWMTFEQIRRFRGSE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 81/281 (29%)
Mito_carr 17..104 CDD:278578 26/77 (34%)
Mito_carr 109..196 CDD:278578 26/94 (28%)
Mito_carr 216..295 CDD:278578 21/81 (26%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 72/254 (28%)
Mito_carr 32..129 CDD:278578 26/73 (36%)
Mito_carr 138..233 CDD:278578 26/96 (27%)
Mito_carr 246..331 CDD:278578 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.