DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and Ucp4C

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:289 Identity:70/289 - (24%)
Similarity:116/289 - (40%) Gaps:42/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CFHPLDVVKTRMQIQGAH-PFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVPPICVETPKRGGKF 93
            |..||||.|||||:.|.. ...|:.:.|... .:..:.|.||..||:.|....:.........:.
  Fly    53 CVFPLDVAKTRMQVDGEQAKKTGKAMPTFRA-TLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRV 116

  Fly    94 LMY---------------ESLKPYFQFGAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQQAH 143
            ::|               |.||.|...|.           ...|..:...|.|||::||:..|..
  Fly   117 VLYDVFRRPFLYQNERNEEVLKIYMALGC-----------SFTAGCIAQALANPFDIVKVRMQTE 170

  Fly   144 RGKR-----LKTLSVVKYIIKHDGY---GIKGLYRGITALVARNAVFHFGFFGFYNALKDIVPSP 200
            ..:|     ::..|:|:..:  |.|   |:..:::|:.....|..:...|..|.|:..|......
  Fly   171 GRRRQLGYDVRVNSMVQAFV--DIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRL 233

  Fly   201 EDKTYNILRKVIIAGLASSLACVMSVTLDMAKCRIQGPQPVKGEVK---YQWTISTIKSTFKEEG 262
            .|....:..:.:.:..|...|.|:|...|:.|.|:.. |||....|   |:.::..::...:|||
  Fly   234 LDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMN-QPVDESGKNLYYKNSLDCVRKLVREEG 297

  Fly   263 FRSLFKGLGAMILRVGPGGAMLLVTYEYL 291
            ..:|:|||.....|:||...:..::.|.|
  Fly   298 VLTLYKGLMPTWFRLGPFSVLFWLSVEQL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 70/289 (24%)
Mito_carr 17..104 CDD:278578 24/89 (27%)
Mito_carr 109..196 CDD:278578 20/94 (21%)
Mito_carr 216..295 CDD:278578 24/79 (30%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 20/71 (28%)
Mito_carr 137..232 CDD:278578 24/107 (22%)
Mito_carr 237..329 CDD:278578 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.