DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and sesB

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:291 Identity:79/291 - (27%)
Similarity:131/291 - (45%) Gaps:17/291 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FLAGGLSGFIEIICFHPLDVVKTRMQIQG-AHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVP 80
            |.|||:|..:......|::.||..:|:|. :.....:..|...:|..::|.:.:|.||.|:|.:.
  Fly    27 FAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLA 91

  Fly    81 PICVETPKRGGKFLMYESLKPYFQFGAPQPTPLTHAMSGSMAA-----ILESFLVNPFEVVKITQ 140
            .:....|.:...|...:..|..|..|..:.|......:|::|:     ......|.|.:..:...
  Fly    92 NVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRL 156

  Fly   141 QAHRGK----RLKTL-SVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVPSP 200
            .|..||    ....| :.:..|.|.|  ||.|||||....|....::...:||||:..:.::|.|
  Fly   157 AADTGKGGQREFTGLGNCLTKIFKSD--GIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDP 219

  Fly   201 EDKTYNILRKVIIAGLASSLACVMSVTLDMAKCRIQGPQPVKG-EVKYQWTISTIKSTFKEEGFR 264
              |...|.....||.:.:::|.::|...|..:.|:......|. ||.|:.|:....:..|:||..
  Fly   220 --KNTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTG 282

  Fly   265 SLFKGLGAMILRVGPGGAMLLVTYEYLFEFL 295
            :.|||..:.||| |.|||.:||.|:.:.:.|
  Fly   283 AFFKGAFSNILR-GTGGAFVLVLYDEIKKVL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 79/291 (27%)
Mito_carr 17..104 CDD:278578 21/87 (24%)
Mito_carr 109..196 CDD:278578 24/96 (25%)
Mito_carr 216..295 CDD:278578 25/79 (32%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 22/88 (25%)
PTZ00169 23..312 CDD:240302 78/289 (27%)
Mito_carr 124..220 CDD:278578 25/99 (25%)
Mito_carr 223..312 CDD:278578 28/89 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.