DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and SPAC328.09

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_594211.1 Gene:SPAC328.09 / 2543171 PomBaseID:SPAC328.09 Length:298 Species:Schizosaccharomyces pombe


Alignment Length:286 Identity:97/286 - (33%)
Similarity:152/286 - (53%) Gaps:14/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVPP 81
            |.||.::|..|::..:||||||||||:.     .|:..|....|.:.||.:.||...|::||:||
pombe    12 FAAGAVAGISEVLTLYPLDVVKTRMQLS-----VGKSDYNGTFDCLKKIVKNEGPHRLYRGILPP 71

  Fly    82 ICVETPKRGGKFLMYESLKPYFQ--FGAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQQ--A 142
            |.:|.|||..||...::....::  |.....:|....::||.|...|:|:|.|||::||..|  .
pombe    72 ILMEAPKRALKFASNDTYSKLWRKVFKRKDSSPALSILTGSCAGFTETFVVVPFELMKIRLQDVK 136

  Fly   143 HRGKRLKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVPSPEDKTYNI 207
            :..|...|:.....|:|.:  .|..||.|..|.:.|:.|::.|:||....:::.: :|.......
pombe   137 NASKYNGTVDCFTKIVKQE--RILALYNGFEATMWRHVVWNAGYFGVIQKIRNSL-TPASSRIGE 198

  Fly   208 LRKVIIAG-LASSLACVMSVTLDMAKCRIQGPQPVKGEV-KYQWTISTIKSTFKEEGFRSLFKGL 270
            :|..:||| :.......:|...|:.|.|||....:.|:| ||.|....:.:..:||||.:|:||.
pombe   199 IRNNLIAGTIGGIFGTFLSTPFDVIKSRIQTVPRIAGQVPKYNWAYPALVTVAREEGFTALYKGF 263

  Fly   271 GAMILRVGPGGAMLLVTYEYLFEFLK 296
            ...:||:||||.:|||.:..:.||.|
pombe   264 VPKVLRLGPGGGILLVVFNSVIEFYK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 96/284 (34%)
Mito_carr 17..104 CDD:278578 34/86 (40%)
Mito_carr 109..196 CDD:278578 27/88 (31%)
Mito_carr 216..295 CDD:278578 28/79 (35%)
SPAC328.09NP_594211.1 Mito_carr 4..97 CDD:278578 34/89 (38%)
PTZ00169 8..284 CDD:240302 94/279 (34%)
Mito_carr 100..190 CDD:278578 27/92 (29%)
Mito_carr 201..290 CDD:278578 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2311
eggNOG 1 0.900 - - E1_KOG0754
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I1117
OMA 1 1.010 - - QHG53612
OrthoFinder 1 1.000 - - FOG0004440
OrthoInspector 1 1.000 - - otm47304
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2643
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.