DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and Slc25a21

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001161448.1 Gene:Slc25a21 / 217593 MGIID:2445059 Length:305 Species:Mus musculus


Alignment Length:279 Identity:113/279 - (40%)
Similarity:174/279 - (62%) Gaps:10/279 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SGFIEIICFHPLDVVKTRMQIQGA--HPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVPPICVE 85
            ||.:||...|||||||||.|:|.:  .|..    |.....:...|:|.|||...:|||:|||..|
Mouse    29 SGLVEICLMHPLDVVKTRFQVQRSVTDPQS----YRTVRGSFQMIFRTEGLFGFYKGIIPPILAE 89

  Fly    86 TPKRGGKFLMYESLKPYFQFGAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQQAHRG---KR 147
            ||||..||..:|..|.:..:.:..| .||..::|..:.:.|:.:||||||||:..|.:|.   ::
Mouse    90 TPKRAVKFSTFELYKKFLGYMSLSP-GLTFLIAGLGSGLTEAVVVNPFEVVKVGLQVNRNLFKEQ 153

  Fly   148 LKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVPSPEDKTYNILRKVI 212
            ..|.:..:.|||.:|.|.:||.:|:||.:.|:.:|:..:||||:.:|:|:||.:|.|...|||..
Mouse   154 PSTFAYARQIIKKEGLGFQGLNKGLTATLGRHGIFNMVYFGFYHNVKNIIPSSKDPTLEFLRKFG 218

  Fly   213 IAGLASSLACVMSVTLDMAKCRIQGPQPVKGEVKYQWTISTIKSTFKEEGFRSLFKGLGAMILRV 277
            |..::.::..|.::..|:||.||||||||.||:||:....|::..::|||..:|:|||...::|:
Mouse   219 IGFVSGTMGSVFNIPFDVAKSRIQGPQPVPGEIKYRSCFKTMEMIYREEGILALYKGLVPKVMRL 283

  Fly   278 GPGGAMLLVTYEYLFEFLK 296
            ||||.::|:.|||.:.:|:
Mouse   284 GPGGGVMLLVYEYTYAWLQ 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 112/277 (40%)
Mito_carr 17..104 CDD:278578 37/82 (45%)
Mito_carr 109..196 CDD:278578 33/89 (37%)
Mito_carr 216..295 CDD:278578 33/78 (42%)
Slc25a21NP_001161448.1 Mito_carr 29..111 CDD:278578 37/85 (44%)
Mito_carr 119..207 CDD:278578 33/87 (38%)
Mito_carr 210..304 CDD:278578 39/93 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850018
Domainoid 1 1.000 90 1.000 Domainoid score I7753
eggNOG 1 0.900 - - E1_KOG0754
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.959148 Normalized mean entropy S891
OMA 1 1.010 - - QHG53612
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004440
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2643
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.760

Return to query results.
Submit another query.