DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9582 and slc-25A21

DIOPT Version :9

Sequence 1:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_510638.2 Gene:slc-25A21 / 181692 WormBaseID:WBGene00011226 Length:289 Species:Caenorhabditis elegans


Alignment Length:286 Identity:108/286 - (37%)
Similarity:177/286 - (61%) Gaps:14/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QFLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVP 80
            |..|||.:|.:|:...:||||||||:|: |....|       .:|.:||..:.||:...:|||:|
 Worm    10 QITAGGSAGLVEVCLMYPLDVVKTRLQL-GQQDKG-------MMDCVVKTLKNEGIGGFYKGILP 66

  Fly    81 PICVETPKRGGKFLMYESLKPYFQFGAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQQAHRG 145
            ||..|||||..||..:|..|..|.. :..|.|:|.:.:|..:.:.|:.::.||||||:..||.|.
 Worm    67 PILAETPKRATKFFTFEQYKIAFTH-SEIPLPVTMSFAGLFSGLTEAIVICPFEVVKVRLQADRN 130

  Fly   146 KRLK----TLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVP-SPEDKTY 205
            ..:|    |.|:.:.|.:::|:|..|||||:.|.:.|:..::..:||.|::.::::| :.::.|.
 Worm   131 SSVKEQRSTASMAREIYRNEGFGTSGLYRGLGATLGRHGAWNMVYFGLYHSCREVIPDAKQNPTS 195

  Fly   206 NILRKVIIAGLASSLACVMSVTLDMAKCRIQGPQPVKGEVKYQWTISTIKSTFKEEGFRSLFKGL 270
            |::.::.:...|.|||.:.::..|:||.|||||||.....||..|:.||...:|||||.:|:|||
 Worm   196 NLIGRIALGFTAGSLASIFNIPFDVAKSRIQGPQPDPFTRKYSGTMQTISLVYKEEGFGALYKGL 260

  Fly   271 GAMILRVGPGGAMLLVTYEYLFEFLK 296
            ...::|:|||||::|:.|:.::.:|:
 Worm   261 LPKVMRLGPGGAVMLIVYDEVYSWLQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 106/283 (37%)
Mito_carr 17..104 CDD:278578 36/86 (42%)
Mito_carr 109..196 CDD:278578 30/90 (33%)
Mito_carr 216..295 CDD:278578 36/78 (46%)
slc-25A21NP_510638.2 PTZ00169 1..281 CDD:240302 107/279 (38%)
Mito_carr 8..92 CDD:278578 38/90 (42%)
Mito_carr 102..188 CDD:278578 27/85 (32%)
Mito_carr 194..288 CDD:278578 39/93 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167184
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0754
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.959148 Normalized mean entropy S891
OMA 1 1.010 - - QHG53612
OrthoDB 1 1.010 - - D1236425at2759
OrthoFinder 1 1.000 - - FOG0004440
OrthoInspector 1 1.000 - - otm14710
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2643
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.770

Return to query results.
Submit another query.