DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IDS and CG7402

DIOPT Version :9

Sequence 1:NP_000193.1 Gene:IDS / 3423 HGNCID:5389 Length:550 Species:Homo sapiens
Sequence 2:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster


Alignment Length:569 Identity:138/569 - (24%)
Similarity:214/569 - (37%) Gaps:169/569 - (29%)


- Green bases have known domain annotations that are detailed below.


Human     9 GLLWLGLVLSSV-CVALGSETQANSTTDALNVLLIIVDDL-RPSLGCYGDKLVRSPNIDQLASHS 71
            |.:.:.||:||: .:|.||   ..||..  |:::|::||: ...:..:|...:.:||||.||.:.
  Fly     4 GKILVLLVVSSILSLAYGS---GYSTKP--NIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNG 63

Human    72 LLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDF----NSYWRVHAGNFSTIPQYFKENGYVTMS 132
            :|....:... :|.|||.:.|||:.|..|.:..|    :..|.:.... ..:|:.|::.||.|..
  Fly    64 ILLNKHYVPN-LCTPSRATLLTGKYPIHTGMQHFVIITDEPWGLPQRE-RLMPEIFRDAGYSTHL 126

Human   133 VGKVFHPGISSNHTDDSP----YSWSFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPE 193
            ||| :|.|..  ..|.:|    :...|..|:...:.|::  ..|..|....|.|....|:...||
  Fly   127 VGK-WHLGFW--RKDLTPTMRGFDHHFGYYNGYIDYYDH--QVRMLDRNYSAGLDFRRDLEPCPE 186

Human   194 --GTLPDKQSTEQAIQLLEKMKTSASPFFLAVGYHKPHI-----PFRYPKEFQKLYPLENITLAP 251
              ||...:..|.:|.:::|:...| .|.|:.:.:...|.     |.:.|:|          .:|.
  Fly   187 ANGTYATEAFTSEAKRIIEQHDKS-KPLFMVLSHLAVHTGNEDSPMQAPEE----------EVAK 240

Human   252 DPEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQRKIRQSYFASVSYLDTQVGRLLS 316
            .|.:.|  |.                                   |::|...:|.||..|.:.:.
  Fly   241 FPHIRD--PK-----------------------------------RRTYAGMISSLDKSVAQTIG 268

Human   317 ALDDLQLANSTIIAFTSDHGWALGEHGEWAKYSNFDVATHVPLIFYVPGRTASLPEAGEKLFPYL 381
            ||.|..:.|::||...||:|                    .|.|.......::.|..|:|..|:.
  Fly   269 ALKDNGMLNNSIILLYSDNG--------------------APTIGIHSNAGSNYPYRGQKESPWE 313

Human   382 DPFDSASQLMEP-----GRQSMDLVELVSLFPTLAGLAGLQVPPRCPVPSFHVELCREGKNLLKH 441
            ....||..|..|     |..|...:..|...|||||.||:.:|...|:         :|.||.  
  Fly   314 GGIRSAGALWSPLLKERGYVSNQAIHAVDWLPTLAGAAGVSLPQDLPL---------DGINLW-- 367

Human   442 FRFRDLEEDPYLPGN----PR-------ELIAYSQYPRPSDIPQWNSDKPSLKDIKIMGYSIRTI 495
                     |.|.||    ||       |:..||.|.|           .:||.:.  |.|.:. 
  Fly   368 ---------PMLSGNEEPKPRTMIHVLDEVFGYSSYMR-----------DTLKYVN--GSSFKG- 409

Human   496 DYRYTVWVGFNPDEFLANFSDIHAGELYFVDSDPL----QDHNMYNDSQ 540
              ||..|:                |||...:.|||    :.|.:.:|.|
  Fly   410 --RYDQWL----------------GELETNEDDPLGESYEQHVLASDVQ 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IDSNP_000193.1 AslA 33..544 CDD:225661 129/544 (24%)
iduronate-2-sulfatase 38..540 CDD:293754 127/537 (24%)
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 130/545 (24%)
4-S 28..436 CDD:293753 126/536 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.